DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and Sgk1

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_001155317.2 Gene:Sgk1 / 20393 MGIID:1340062 Length:524 Species:Mus musculus


Alignment Length:345 Identity:138/345 - (40%)
Similarity:199/345 - (57%) Gaps:25/345 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 NDFKIIRVLGTGAYGRVFLVRKLTRHDAGKL-YAMKVLNKITVVQKRKTAEHTKTERVVLEAIQR 322
            :||..::|:|.|::|:|.    |.||.|.:: ||:|||.|..:: |:|..:|..:||.||....:
Mouse   189 SDFHFLKVIGKGSFGKVL----LARHKAEEVFYAVKVLQKKAIL-KKKEEKHIMSERNVLLKNVK 248

  Fly   323 NPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLHQLGIIY 387
            :||||.||::||::.|||.|||:.||||||.||.....|.|.|.|.|.||:..||..||.|.|:|
Mouse   249 HPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVY 313

  Fly   388 RDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVDWWS 452
            ||:|.||||||.:|||||:||||.| ...|:.....:||||.||:|||::...|  :|..||||.
Mouse   314 RDLKPENILLDSQGHIVLTDFGLCK-ENIEHNGTTSTFCGTPEYLAPEVLHKQP--YDRTVDWWC 375

  Fly   453 VGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLGGN 517
            :|.:.:|:|.|..||.:.:.......|..:..:.:|.|.:|    ||..:..:|:|:..:|||..
Mouse   376 LGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNS----ARHLLEGLLQKDRTKRLGAK 436

  Fly   518 HRDASEIKEHPFFNGINWQELRTKRRKAPYKPTLTAEDDVQNFSNEFTDQVPEDPECDAPPSRI- 581
            . |..|||.|.||:.|||.:|..|:...|:.|.::...|:::|..|||:: |........|..| 
Mouse   437 D-DFMEIKSHIFFSLINWDDLINKKITPPFNPNVSGPSDLRHFDPEFTEE-PVPSSIGRSPDSIL 499

  Fly   582 ---------RLFRGYTYVAP 592
                     ..|.|::|..|
Mouse   500 VTASVKEAAEAFLGFSYAPP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 116/269 (43%)
STKc_MSK_N 266..533 CDD:270735 117/267 (44%)
S_TK_X 532..591 CDD:214529 18/68 (26%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
Sgk1NP_001155317.2 STKc_SGK1 183..521 CDD:270753 138/345 (40%)
S_TKc 191..448 CDD:214567 116/269 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.