DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and F28C10.3

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_508114.2 Gene:F28C10.3 / 180405 WormBaseID:WBGene00017898 Length:349 Species:Caenorhabditis elegans


Alignment Length:295 Identity:98/295 - (33%)
Similarity:163/295 - (55%) Gaps:12/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 AVSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAGKLYAMKVLNKITVVQKRKTAEHTKTERVVLEA 319
            |.::.||:|::.:|:||||.|..||||...|...:|||||:.|..:.:.:...||   |..:|..
 Worm    23 AATIEDFEILKHIGSGAYGEVAAVRKLNGCDTETIYAMKVMEKRRMSKHKDMVEH---EWKILTT 84

  Fly   320 IQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLHQLG 384
            | .|||.:.:.|:||:...|..|:.||.||::.|.:.:....||| ...|:.|:|..:..||:..
 Worm    85 I-HNPFFMKMSYSFQTKRHLVFVMPFAGGGDMLTMMENECLIEES-AHFYLCELVEGIGYLHEKH 147

  Fly   385 IIYRDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVD 449
            |::||:||||:|:..:||::::|:||| ....:.|.......||...||||:......|  ::.|
 Worm   148 IVHRDVKLENLLIGNDGHLMITDYGLS-ATGCDAEDAIQGVIGTRHTMAPEVHLEKKYG--TSCD 209

  Fly   450 WWSVGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRL 514
            ||:||:...::.:..:.|..:|.:    |.|....|::|.:|...|...|.||.|::.::|.:||
 Worm   210 WWAVGITYCDMRSDKAVFDGADSK----EYSDSTAKKRPRLPKVLSPRERGFVNKLIVRDPTQRL 270

  Fly   515 GGNHRDASEIKEHPFFNGINWQELRTKRRKAPYKP 549
            |......:.:|.|..|.|:.|:::..|:...|:.|
 Worm   271 GNGPDGTATVKAHDMFKGVVWEDVLAKKLVPPFIP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 90/268 (34%)
STKc_MSK_N 266..533 CDD:270735 89/266 (33%)
S_TK_X 532..591 CDD:214529 5/18 (28%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
F28C10.3NP_508114.2 S_TKc 29..286 CDD:214567 90/268 (34%)
STKc_AGC 35..286 CDD:270693 88/262 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.