DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and akt3b

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:XP_001923454.3 Gene:akt3b / 100149794 ZFINID:ZDB-GENE-110309-3 Length:479 Species:Danio rerio


Alignment Length:389 Identity:145/389 - (37%)
Similarity:211/389 - (54%) Gaps:44/389 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 TPSYAMPTSNSTPLDLDNEAHQRDLEAVTDLKYYVKLYSDEAVSLNDFKIIRVLGTGAYGRVFLV 278
            :|...:...|...:|.....|:|.                   ::|||..:::||.|.:|:|.||
Zfish   120 SPISQIENVNEEEMDTSTSHHKRK-------------------TMNDFDYLKLLGKGTFGKVILV 165

  Fly   279 RKLTRHDAGKLYAMKVLNKITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVL 343
            |:..   :|..||||:|.|..::.|.:.| ||.||..||:. .|:|||.||.|:||:..:|..|:
Zfish   166 REKA---SGTYYAMKILKKEVIIAKDEVA-HTLTESRVLKN-TRHPFLTSLKYSFQTKDRLCFVM 225

  Fly   344 DFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIKLENILLDGEGHIVLSDF 408
            ::.||||||.||.....|.|.|.|.|.||:|.||:.||...|:|||:||||::||.:|||.::||
Zfish   226 EYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDF 290

  Fly   409 GLSK--ILTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVDWWSVGVLTFELLTGASPFATSD 471
            ||.|  |..|..   ..:||||.||:|||::.....|.  |||||.:||:.:|::.|..||...|
Zfish   291 GLCKEGITDAAT---MKTFCGTPEYLAPEVLEDNDYGR--AVDWWGLGVVMYEMMCGRLPFYNQD 350

  Fly   472 GQVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFFNGINWQ 536
                ..::...|..|:...|.:.||:|:..:..:|.|:|.:||||...||.||..|.||..::||
Zfish   351 ----HEKLFELILMEEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFTALDWQ 411

  Fly   537 ELRTKRRKAPYKPTLTAEDDVQNFSNEFTDQV-----PE---DPECDAPPSRIR-LFRGYTYVA 591
            ::..|:...|:.|.:::|.|.:.|..|||.|.     ||   :...||..|..| .|..::|.|
Zfish   412 DVYDKKLVPPFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADSERRPHFPQFSYSA 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 115/270 (43%)
STKc_MSK_N 266..533 CDD:270735 116/268 (43%)
S_TK_X 532..591 CDD:214529 20/67 (30%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
akt3bXP_001923454.3 PH_PKB 4..109 CDD:269947
PH 6..105 CDD:278594
PKc_like 132..479 CDD:304357 143/377 (38%)
S_TKc 148..405 CDD:214567 115/270 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.