DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs1 and CNX3

DIOPT Version :9

Sequence 1:NP_788494.1 Gene:Mocs1 / 39238 FlyBaseID:FBgn0263241 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001154299.1 Gene:CNX3 / 839445 AraportID:AT1G01290 Length:270 Species:Arabidopsis thaliana


Alignment Length:175 Identity:93/175 - (53%)
Similarity:121/175 - (69%) Gaps:8/175 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 YHHAYHTSRLQLQ--------ARNYSQLTHVDGQGKAQMVDVGAKPSTTRLARAEATVQVGEKLT 438
            ||.:.|:|:...|        |.:.|:||||...|:||||||.:|.::.|.|.|...|.:|:::.
plant    89 YHKSTHSSKNDSQAIEQYAKVASDMSKLTHVGIAGEAQMVDVSSKDNSKRTALACCKVILGKRVF 153

  Fly   439 QLIADNQVAKGDVLTVAQIAGIMGAKRTAELIPLCHNISLSSVKVQATLLKTEQSVRLEATVRCS 503
            .|:..||:.|||||.||:||||.|||:|:.||||||||:|:.|:|...|...:.||.:|....|:
plant   154 DLVLANQMGKGDVLGVAKIAGINGAKQTSSLIPLCHNIALTHVRVDLRLNPEDFSVDIEGEASCT 218

  Fly   504 GQTGVEMEALTAVSVAALTVYDMCKAVSHDICITNVRLLSKSGGK 548
            |:|||||||:||||||.|||||||||.|.||.||:|||..|:|||
plant   219 GKTGVEMEAMTAVSVAGLTVYDMCKAASKDISITDVRLERKTGGK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mocs1NP_788494.1 moaA 59..366 CDD:234672
Radical_SAM 74..249 CDD:100105
Mob_synth_C 240..367 CDD:283994
moaC 399..555 CDD:236483 87/150 (58%)
CNX3NP_001154299.1 PLN02375 1..269 CDD:178003 93/175 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 146 1.000 Domainoid score I1458
eggNOG 1 0.900 - - E1_COG2896
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22960
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.