DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs1 and CNX2

DIOPT Version :9

Sequence 1:NP_788494.1 Gene:Mocs1 / 39238 FlyBaseID:FBgn0263241 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001031461.1 Gene:CNX2 / 817754 AraportID:AT2G31955 Length:390 Species:Arabidopsis thaliana


Alignment Length:377 Identity:198/377 - (52%)
Similarity:255/377 - (67%) Gaps:24/377 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLGQENSAGEVASLSRGAIRLKATTGYLNLATASVQPLEPEKQVLRKNSP----LTDSFGRHHTY 71
            |:|.|..:|.|.       |...||....|.::|....:.: |:  |::|    |.|.|||.|||
plant    22 LVGSEVGSGSVT-------RTITTTTSERLFSSSYAAHQVD-QI--KDNPVSDMLIDKFGRLHTY 76

  Fly    72 LRISLTERCNLRCDYCMPAEGVPLQPKNKLLTTEEILRLARIFVEQGVRKIRLTGGEPTVRRDIV 136
            |||||||||||||.||||:|||.|.||.:||:..||:|||.:||..||.||||||||||||:||.
plant    77 LRISLTERCNLRCQYCMPSEGVELTPKPQLLSQSEIVRLAGLFVSAGVNKIRLTGGEPTVRKDIE 141

  Fly   137 EIVAQMKALPELEQIGITTNGLVLTRLLLPLQRAGLDNLNISLDTLKRDRFEKITRRKGWERVIA 201
            ||..|:.:|..|:.:.|||||:.|.:.|..|:..|||:||||||||...:||.:|||||.:||:.
plant   142 EICLQLSSLKGLKNLAITTNGITLAKKLPRLKECGLDSLNISLDTLVPAKFEFLTRRKGHDRVMK 206

  Fly   202 GIDLAVQLGYRP-KVNCVLMRDFNEDEICDFVEFTRNRPVDVRFIEYMPFSGNKWHTERLISYKD 265
            .||.|::|||.| |||||:||..|:||||||||.||::|::|||||:|||.||.|:.::|:.|.:
plant   207 SIDTAIELGYNPVKVNCVIMRGLNDDEICDFVELTRDKPINVRFIEFMPFDGNVWNVKKLVPYAE 271

  Fly   266 TLQIIRQRWPDFKALPNGPNDTSKAYAVPGFKGQVGFITSMTEHFCGTCNRLRLTADGNIKVCLF 330
            .:..:.:|:|..|.:.:.|.:|:|.:.:.|..|.|.||||||||||..||||||.||||.|||||
plant   272 VMDKVVKRFPSIKRMQDHPTETAKNFTIDGHCGSVSFITSMTEHFCAGCNRLRLLADGNFKVCLF 336

  Fly   331 GNKEFSLRDAMRDESVSEEQLVDLIGAAVQRKKKQHA---DAA-----PRLH 374
            |..|.||||.:| ....:|.|.::|||||:|||..||   |.|     |.:|
plant   337 GPSEVSLRDPLR-SGADDEALREIIGAAVKRKKAAHAGMLDIAKTANRPMIH 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mocs1NP_788494.1 moaA 59..366 CDD:234672 180/311 (58%)
Radical_SAM 74..249 CDD:100105 110/175 (63%)
Mob_synth_C 240..367 CDD:283994 64/126 (51%)
moaC 399..555 CDD:236483
CNX2NP_001031461.1 PLN02951 5..390 CDD:215513 198/377 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 203 1.000 Domainoid score I852
eggNOG 1 0.900 - - E1_COG2896
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4343
Inparanoid 1 1.050 367 1.000 Inparanoid score I573
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D721528at2759
OrthoFinder 1 1.000 - - FOG0005129
OrthoInspector 1 1.000 - - oto2830
orthoMCL 1 0.900 - - OOG6_101306
Panther 1 1.100 - - LDO PTHR22960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3650
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.