DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32069 and YOS1

DIOPT Version :9

Sequence 1:NP_729654.1 Gene:CG32069 / 39235 FlyBaseID:FBgn0052069 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_219496.2 Gene:YOS1 / 856806 SGDID:S000007651 Length:85 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:36/83 - (43%)
Similarity:53/83 - (63%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQD-FGAP--TAKDQVLNLIRSIRTVAK 62
            :|.|..|....||.:|||.:|.|||||.:.|.||...:.. ||..  |.|.:|:.||.:::|:.:
Yeast     3 LFGLGRLFYVILLLINAVAVLSEERFLRRIGLGRSNDETPVFGQDQNTTKSKVVQLIGAVQTLLR 67

  Fly    63 IPLIFLNIIAIIFKLLLG 80
            ||||.:||:.|:::||||
Yeast    68 IPLIGINILVIVYELLLG 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32069NP_729654.1 Yos1 4..80 CDD:400748 33/78 (42%)
YOS1NP_219496.2 Yos1 6..85 CDD:400748 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346062
Domainoid 1 1.000 61 1.000 Domainoid score I2538
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1762
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52932
OrthoFinder 1 1.000 - - FOG0004271
OrthoInspector 1 1.000 - - oto100343
orthoMCL 1 0.900 - - OOG6_103811
Panther 1 1.100 - - LDO PTHR15858
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1988
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.890

Return to query results.
Submit another query.