DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32069 and ier3ip1

DIOPT Version :9

Sequence 1:NP_729654.1 Gene:CG32069 / 39235 FlyBaseID:FBgn0052069 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_001239302.1 Gene:ier3ip1 / 554110 ZFINID:ZDB-GENE-050506-106 Length:82 Species:Danio rerio


Alignment Length:80 Identity:42/80 - (52%)
Similarity:58/80 - (72%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFG-APTAKDQVLNLIRSIRTVAKIPL 65
            |||:.||::::|..||:.:|||||||:|.|||.:.|...|| .|..|.|:||||||:|||.::||
Zfish     3 FTLYALIQTAILFTNAIAVLHEERFLSKIGWGAEQGVGGFGDDPGIKAQLLNLIRSVRTVMRVPL 67

  Fly    66 IFLNIIAIIFKLLLG 80
            |.:|.:.|:..||.|
Zfish    68 IAVNSVCIVLLLLFG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32069NP_729654.1 Yos1 4..80 CDD:400748 39/76 (51%)
ier3ip1NP_001239302.1 Yos1 5..82 CDD:285740 39/76 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594708
Domainoid 1 1.000 83 1.000 Domainoid score I8315
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5129
OMA 1 1.010 - - QHG52932
OrthoDB 1 1.010 - - D1624874at2759
OrthoFinder 1 1.000 - - FOG0004271
OrthoInspector 1 1.000 - - oto40104
orthoMCL 1 0.900 - - OOG6_103811
Panther 1 1.100 - - LDO PTHR15858
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1988
SonicParanoid 1 1.000 - - X6097
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.