DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32069 and AT3G54085

DIOPT Version :9

Sequence 1:NP_729654.1 Gene:CG32069 / 39235 FlyBaseID:FBgn0052069 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_001078282.1 Gene:AT3G54085 / 5008085 AraportID:AT3G54085 Length:78 Species:Arabidopsis thaliana


Alignment Length:76 Identity:27/76 - (35%)
Similarity:44/76 - (57%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFGAPTAKDQVLNLIRSIRTVAKIPLIFLN 69
            |||::..||..||:.||:|:|||...||......|.....:.|.|::.||.:.:.: ::||:.:|
plant     4 WTLLKGLLLFANALAILNEDRFLVPRGWTLGELHQTDRRNSPKGQIIGLIHACQYM-RLPLMLIN 67

  Fly    70 IIAIIFKLLLG 80
            ...|:.||:.|
plant    68 TAVIVLKLISG 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32069NP_729654.1 Yos1 4..80 CDD:400748 26/74 (35%)
AT3G54085NP_001078282.1 Yos1 3..78 CDD:369963 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I4001
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2579
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624874at2759
OrthoFinder 1 1.000 - - FOG0004271
OrthoInspector 1 1.000 - - otm2405
orthoMCL 1 0.900 - - OOG6_103811
Panther 1 1.100 - - O PTHR15858
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.