DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32069 and Hdhd2

DIOPT Version :9

Sequence 1:NP_729654.1 Gene:CG32069 / 39235 FlyBaseID:FBgn0052069 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_001014173.2 Gene:Hdhd2 / 361351 RGDID:1308579 Length:384 Species:Rattus norvegicus


Alignment Length:62 Identity:34/62 - (54%)
Similarity:46/62 - (74%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFG-APTAKDQVLNLIRSIRTVAK 62
            |||::|::::|||:||:.:|||||||...|||...|...|| .|..|.|:||||||:|||.:
  Rat     3 FTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIRSVRTVMR 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32069NP_729654.1 Yos1 4..80 CDD:400748 32/60 (53%)
Hdhd2NP_001014173.2 Yos1 5..>64 CDD:285740 32/58 (55%)
HAD-SF-IIA-hyp3 122..382 CDD:162372
HAD_like <159..>211 CDD:304363
Hydrolase_like 301..375 CDD:289983
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7970
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5024
OMA 1 1.010 - - QHG52932
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004271
OrthoInspector 1 1.000 - - oto98795
orthoMCL 1 0.900 - - OOG6_103811
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6097
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.