Sequence 1: | NP_729654.1 | Gene: | CG32069 / 39235 | FlyBaseID: | FBgn0052069 | Length: | 80 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014173.2 | Gene: | Hdhd2 / 361351 | RGDID: | 1308579 | Length: | 384 | Species: | Rattus norvegicus |
Alignment Length: | 62 | Identity: | 34/62 - (54%) |
---|---|---|---|
Similarity: | 46/62 - (74%) | Gaps: | 1/62 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 FTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFG-APTAKDQVLNLIRSIRTVAK 62 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32069 | NP_729654.1 | Yos1 | 4..80 | CDD:400748 | 32/60 (53%) |
Hdhd2 | NP_001014173.2 | Yos1 | 5..>64 | CDD:285740 | 32/58 (55%) |
HAD-SF-IIA-hyp3 | 122..382 | CDD:162372 | |||
HAD_like | <159..>211 | CDD:304363 | |||
Hydrolase_like | 301..375 | CDD:289983 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 86 | 1.000 | Domainoid score | I7970 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 90 | 1.000 | Inparanoid score | I5024 |
OMA | 1 | 1.010 | - | - | QHG52932 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0004271 | |
OrthoInspector | 1 | 1.000 | - | - | oto98795 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_103811 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X6097 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.870 |