DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blos2 and Bloc1s2

DIOPT Version :10

Sequence 1:NP_648427.1 Gene:Blos2 / 39234 FlyBaseID:FBgn0036118 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001032426.1 Gene:Bloc1s2 / 293938 RGDID:1306551 Length:142 Species:Rattus norvegicus


Alignment Length:143 Identity:57/143 - (39%)
Similarity:82/143 - (57%) Gaps:2/143 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AAAAAAQDSNLLPDSPQHGPTLSSASSFEALTRHDPNLSRLATKMFNKTEEYITHELNAPLEDYK 72
            ||||....:....:.|:....:.:|.  ||....:.:::.|...||:|...|:|.||.|..||||
  Rat     2 AAAAEGVPATRREEPPRDDAAVETAE--EAKEPAEADINELCRDMFSKMATYLTGELTATSEDYK 64

  Fly    73 LLEEMNKATIAKYKDMRQIAENLNTSTSELSLKFQQLAPMMQQIDEISDTVDKLEAAAYKLDAYS 137
            |||.|||.|..||.:|:.||.|::.:..:|:.|:..|.|.:.||:.|.:.|..||.|||||||||
  Rat    65 LLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYS 129

  Fly   138 IALENRVKCVLQR 150
            ..||.:.|.:.:|
  Rat   130 KKLEAKYKKLEKR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blos2NP_648427.1 BLOC1_2 50..145 CDD:462951 46/94 (49%)
Bloc1s2NP_001032426.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 8/32 (25%)
BLOC1_2 42..137 CDD:462951 46/94 (49%)

Return to query results.
Submit another query.