DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and GPT2

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_597700.1 Gene:GPT2 / 84706 HGNCID:18062 Length:523 Species:Homo sapiens


Alignment Length:489 Identity:99/489 - (20%)
Similarity:170/489 - (34%) Gaps:154/489 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNLGVGAPGPDILTANCDS-----------FRTATDHCL------------EREKRENQSL---- 64
            |..|:..|..:::.||...           .|.....|.            :.:||..:.|    
Human    79 LQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACG 143

  Fly    65 ---IFQYGPTSGTFEVRREISTYFTEMFKS-PVNCEDLIITTGASHGLHILLSTMLDFEG----- 120
               :..|..:.|...:|.:::.|.|..... |.:.:::.:|||||.|:..:|..::...|     
Human   144 GNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTG 208

  Fly   121 -FVFVDEYTYMIA----LDSIKHFSTVTIVPVKLNDD---GVDLKDLEEKVSKRRFQSKKKEFWG 177
             .:.:.:|....|    ||:|:       |...|:::   .:::.:|...|.:.:.....|    
Human   209 VMIPIPQYPLYSAVISELDAIQ-------VNYYLDEENCWALNVNELRRAVQEAKDHCDPK---- 262

  Fly   178 IYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVY--NILN------------YGETPT 228
             ...|....||||.:.|.:....::..|......::.|:||  |:.:            |...|.
Human   263 -VLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPE 326

  Fly   229 HSRLLSYDDRNDANFAGHVISNGSFSKILGPGVRLGWLEVPPRLKPILDG--------------S 279
            :|..:..     |:|  |..|.|...:.   |.|.|::|| ..|.|.:.|              |
Human   327 YSSNVEL-----ASF--HSTSKGYMGEC---GYRGGYMEV-INLHPEIKGQLVKLLSVRLCPPVS 380

  Fly   280 GFATSGGCFNNYTSGIVGSLFELKLAQKQISESYEAY---KERMLAT-------TQVLRDELP-- 332
            |.|......|...:|               .||:|.:   ||.:|..       |:.|.:::|  
Human   381 GQAAMDIVVNPPVAG---------------EESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGI 430

  Fly   333 DCCKLVSPTGGYFIWVRI----------------PDRLDCREFLKYCMENHKIYFIVGTRFSADG 381
            .|..|   .|..:.:.||                ||...|.:.|    |...|..:.|:.|   |
Human   431 HCNPL---QGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLL----EETGICVVPGSGF---G 485

  Fly   382 Q-SGKQFFRLSIAFYPKSKLVDGARRLCNALKDY 414
            | .|...||::| ..|..||    :.:...:||:
Human   486 QREGTYHFRMTI-LPPVEKL----KTVLQKVKDF 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 98/487 (20%)
AAT_like 27..407 CDD:99734 97/480 (20%)
GPT2NP_597700.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
PTZ00377 48..523 CDD:240391 99/489 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.