DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and ACS10

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_564804.1 Gene:ACS10 / 842598 AraportID:AT1G62960 Length:557 Species:Arabidopsis thaliana


Alignment Length:222 Identity:55/222 - (24%)
Similarity:93/222 - (41%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DHCLEREKRE-----NQSLIFQYGPTSGTFEVRREISTYFTEMFKSPVNCE--DLIITTGASHGL 108
            |..||..|..     :.|.|..|.|:.|..|::..::.:.||..|:.|..:  .|::|:|||..:
plant   184 DWVLENPKEAISDGLSISGIASYEPSDGLLELKMAVAGFMTEATKNSVTFDPSQLVLTSGASSAI 248

  Fly   109 HILLSTMLDFEGFVFVDEYTYMIALD-SIKHFSTVTIVPVKLNDDGVDLKDLEEKVSKRRF-QSK 171
            .||...:.| .|..|:.........| .:|..:.|.|:.|...  ..|..::...|..|.| |:|
plant   249 EILSFCLAD-SGNAFLVPTPCSPGYDRDVKWRTGVDIIHVPCR--SADNFNMSMVVLDRAFYQAK 310

  Fly   172 KK--EFWGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVY---------------N 219
            |:  ...||..:.|:  ||.|.|.|.|....::..||..:..::.::::               .
plant   311 KRGVRIRGIIISNPS--NPMGSLLSRENLYALLDFARERNIHIISNEIFAGSVHGEEGEFVSMAE 373

  Fly   220 ILNYGETPTHSRL-LSYDDRNDANFAG 245
            |::..|.....|: :.||...|.:|.|
plant   374 IVDTEENIDRERVHIVYDLSKDLSFRG 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 55/222 (25%)
AAT_like 27..407 CDD:99734 55/222 (25%)
ACS10NP_564804.1 PLN02450 133..557 CDD:178069 55/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.