DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and ACS2

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_171655.1 Gene:ACS2 / 837082 AraportID:AT1G01480 Length:496 Species:Arabidopsis thaliana


Alignment Length:452 Identity:93/452 - (20%)
Similarity:164/452 - (36%) Gaps:113/452 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSQDRKLKHLFDGGDWNVYAPN----------ILNLGVG-------------APGPDILTANCDS 45
            ::|..:....|||  |..|..:          |:.:|:.             ...|:......:.
plant    18 NNQHGENSEYFDG--WKAYDKDPFHLSRNPHGIIQMGLAENQLCLDLIKDWVKENPEASICTLEG 80

  Fly    46 FRTATD-------HCLEREKRENQSLIFQYGPTSG---TFEVRREISTYFTEMFKSPVNCEDLII 100
            ....:|       |.|   |:..|::....|...|   ||:..|                   ::
plant    81 IHQFSDIANFQDYHGL---KKFRQAIAHFMGKARGGRVTFDPER-------------------VV 123

  Fly   101 TTGASHGLHILLSTMLDFEGFVFVDEYTYMIALDSIKHFST-VTIVPVKL-NDDGVDLK-DLEEK 162
            .:|.:.|.:..:...|...|.||:....|..|.|....:.| |.|:||.. :.|...|. |..|.
plant   124 MSGGATGANETIMFCLADPGDVFLIPSPYYAAFDRDLRWRTGVEIIPVPCSSSDNFKLTVDAAEW 188

  Fly   163 VSKRRFQSKKKEFWGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVY--NILNYGE 225
            ..|:..:|.|| ..|:..|.|:  ||.|.:...:....:|:.....:..:|.|::|  .:...|:
plant   189 AYKKAQESNKK-VKGLILTNPS--NPLGTMLDKDTLTNLVRFVTRKNIHLVVDEIYAATVFAGGD 250

  Fly   226 TPTHSRLLSYDDRNDANF-AGHVISNGSFSKILG-PGVRLGWLEVPPRLKPILDGSGFATS-GGC 287
            ..:.:.:::..|.::.|. ..|::.  |.||.:| ||.|:|.:            ..|..| ..|
plant   251 FVSVAEVVNDVDISEVNVDLIHIVY--SLSKDMGLPGFRVGIV------------YSFNDSVVSC 301

  Fly   288 FNNYTS-GIVGSLFELKLA----QKQISESYEAYKERMLA------TTQVLRDELPDCCKLVSPT 341
            ....:| |:|.|..:|.||    ..|..:::.....|.|.      ||.:.:.::  .|  ::..
plant   302 ARKMSSFGLVSSQTQLMLASMLSDDQFVDNFLMESSRRLGIRHKVFTTGIKKADI--AC--LTSN 362

  Fly   342 GGYFIWVRIPDRLDCREFL--KYCMENH-KIYFIVGTRFSADGQSGKQF-------FRLSIA 393
            .|.|.|      :|.|..|  :...|:. :::.|:..|...:...|..|       ||:..|
plant   363 AGLFAW------MDLRHLLRDRNSFESEIELWHIIIDRVKLNVSPGSSFRCTEPGWFRICFA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 87/431 (20%)
AAT_like 27..407 CDD:99734 86/419 (21%)
ACS2NP_171655.1 PLN02376 1..496 CDD:178004 93/452 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.