DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and ACS5

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_201381.1 Gene:ACS5 / 836709 AraportID:AT5G65800 Length:470 Species:Arabidopsis thaliana


Alignment Length:320 Identity:65/320 - (20%)
Similarity:130/320 - (40%) Gaps:33/320 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KRENQSL-----IFQYGPTSGTFEVRREISTYFTEMFKSPVNCE--DLIITTGASHGLHILLSTM 115
            ||..||:     :||  ...|..|.::.::.:..|:..:.|..:  .:::..|::.....|:..:
plant    69 KRNGQSIFRELALFQ--DYHGMPEFKKAMAEFMEEIRGNRVTFDPKKIVLAAGSTSANETLMFCL 131

  Fly   116 LDFEGFVFVDEYTYMIALD-SIKHFSTVTIVPVKL-NDDGVDLKDLEEKVSKRRFQSKKK---EF 175
            .: .|..|:....|....| .:|..:...|||:.. :.:|.   .:.|...::.:|..:|   :.
plant   132 AE-PGDAFLLPTPYYPGFDRDLKWRTGAEIVPIHCSSSNGF---QITESALQQAYQQAQKLDLKV 192

  Fly   176 WGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHSRLLSYDDR-- 238
            .|:..|.|:  ||.|...:......:|....:.:..::.|::|:...:|.....|.:....|:  
plant   193 KGVLVTNPS--NPLGTALTRRELNLLVDFITSKNIHLISDEIYSGTMFGFEQFISVMDVLKDKKL 255

  Fly   239 --NDANFAGHVISNGSFSKILG-PGVRLGWLEVPPRLKPILDGSGFATSGGCFNNYTSGIVGSLF 300
              .:.:...||:.  |.||.|| ||.|:|.:.....:  |:..:...:|.|..::.|..::.:|.
plant   256 EDTEVSKRVHVVY--SLSKDLGLPGFRVGAIYSNDEM--IVSAATKMSSFGLVSSQTQYLLSALL 316

  Fly   301 -ELKLAQKQISESYEAYKERMLATTQVLRDELPDCCKLVSPTGGYFIWVRIPDRLDCREF 359
             :.|...:.:.|:.:..|.|.......|......|.:   ...|.|.||.:...||...|
plant   317 SDKKFTSQYLEENQKRLKSRQRRLVSGLESAGITCLR---SNAGLFCWVDMRHLLDTNTF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 65/320 (20%)
AAT_like 27..407 CDD:99734 65/320 (20%)
ACS5NP_201381.1 PLN02450 1..469 CDD:178069 65/320 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.