DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and ACS12

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_199982.2 Gene:ACS12 / 835243 AraportID:AT5G51690 Length:495 Species:Arabidopsis thaliana


Alignment Length:321 Identity:70/321 - (21%)
Similarity:123/321 - (38%) Gaps:74/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SLIFQYGPTSGTFEVRREISTYFTEMFKSPVNCE--DLIITTGASHGLHILLSTMLDFEGFVFVD 125
            |.|..|.|..|..|:|...:.:.:.:....|:.:  :::||.|.:..:.:|...:.| .|..|:.
plant   143 SSIAMYKPFEGLLELRVAFADFMSRIMGGNVSFDPSNMVITAGGTPAIEVLAFCLAD-HGNAFLI 206

  Fly   126 EYTYMIALD-SIKHFSTVTIVPVKLNDDG---VDLKDLEEKVSKRRFQSKKKEFWGIYYTIPTYH 186
            ...|....| .||..:.|.::||......   |.:..||:.:::.|.:..|..  ||.::.|:  
plant   207 PTPYYPGFDRDIKFRTGVELIPVHCRSSDNFTVTVSALEQALNQARKRGSKVS--GILFSNPS-- 267

  Fly   187 NPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHSRLLSYDDRNDANFAGHVISNG 251
            ||.|.:.|.|....|::.|:..:..|:.|:::....||            |:...:.| .:..:|
plant   268 NPVGNILSRETLCDILRFAQEKNIHVISDEIFAGSVYG------------DKEFVSMA-EIAGSG 319

  Fly   252 SFSK-----ILG-------PGVRLGWL-----EVPPRLKPILDGSGFATSGGCFNNYTSGIVGSL 299
            .|.|     |.|       ||.|.|.:     :|....|.::..|....           :|..:
plant   320 EFDKTRVHIIYGLSKDLSIPGFRAGVIYSFHEDVVNAAKKLMRFSSVPV-----------LVQRI 373

  Fly   300 FELKLAQKQISESYEAYKERMLATTQVLRDE------------LPDCCKLVSPTGGYFIWV 348
            ....|:..:..|.|      |.|..|.:||:            :| |.:   ..||.:.||
plant   374 LISLLSDVRFIEGY------MAAHRQRIRDKHIRFVEGLKQLGIP-CAE---SGGGLYCWV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 70/321 (22%)
AAT_like 27..407 CDD:99734 70/321 (22%)
ACS12NP_199982.2 PLN02450 70..495 CDD:178069 70/321 (22%)
AAT_I 81..213 CDD:302748 16/70 (23%)
AAT_like 148..488 CDD:99734 68/316 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.