DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and ACS8

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_195491.1 Gene:ACS8 / 829933 AraportID:AT4G37770 Length:469 Species:Arabidopsis thaliana


Alignment Length:445 Identity:93/445 - (20%)
Similarity:148/445 - (33%) Gaps:121/445 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WNVYAPN----------ILNLGVG-------------APGPDILTANCDSFRTATDHCLEREKRE 60
            |..|..|          |:.:|:.             |..||  .||.              :||
plant    23 WEEYEKNPYDEIKNPDGIIQMGLAENQLSFDLIESWLAKNPD--AANF--------------QRE 71

  Fly    61 NQSL-----IFQYGPTSGTFEVRREISTYFTEMFKSPV--NCEDLIITTGASHGLHILLSTMLDF 118
            .||:     :||  ...|....:..::.:.:|...:.|  |...|::|.||:.....|:..:.| 
plant    72 GQSIFRELALFQ--DYHGLPSFKNAMADFMSENRGNRVSFNPNKLVLTAGATPANETLMFCLAD- 133

  Fly   119 EGFVFVDEYTYMIALD-SIKHFSTVTIVPVKLNDDG------VDLKDLEEKVSKRRFQSKKKEFW 176
            .|..|:....|....| .:|..:...|||::.....      |.|::..|:..|...:.|     
plant   134 PGDAFLLPTPYYPGFDRDLKWRTGAEIVPIQCKSANGFRITKVALEEAYEQAQKLNLKVK----- 193

  Fly   177 GIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHSRLLS----YDD 237
            |:..|.|:  ||.|...:......::.........::.|::|:    |...|:...:|    ..|
plant   194 GVLITNPS--NPLGTTTTRTELNHLLDFISRKKIHLISDEIYS----GTVFTNPGFISVMEVLKD 252

  Fly   238 R----NDANFAGHVISNGSFSKILG-PGVRLGWLEVPPRLKPILDGSGFATSG-------GCFNN 290
            |    .|.....|::.  |.||.|| ||.|:|         .|.....|..|.       |..::
plant   253 RKLENTDVFDRVHIVY--SLSKDLGLPGFRVG---------VIYSNDDFVVSAATKMSSFGLISS 306

  Fly   291 YTSGIVGSLFELKLAQKQ-ISESYEAYKERMLATTQVLRDELPDCCKLVSPTGGYFIWVRIPDRL 354
            .|..::.:|...|...|. :.|:....|.|.......|.....:|.|   ...|.|.||      
plant   307 QTQYLLSALLSDKTFTKNYLEENQIRLKNRHKKLVSGLEAAGIECLK---SNAGLFCWV------ 362

  Fly   355 DCREFLKYCMENHKIYFIVGTRFSADGQSGKQFFRLSIAFYPKSKLVDGARRLCN 409
            |.|..||            ...|.|:.:..|:     |.:..|..:..|:...||
plant   363 DMRHLLK------------SNTFEAEIELWKK-----IVYEVKLNISPGSSCHCN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 91/439 (21%)
AAT_like 27..407 CDD:99734 87/423 (21%)
ACS8NP_195491.1 PLN02450 1..468 CDD:178069 93/445 (21%)
AAT_I 3..147 CDD:302748 29/142 (20%)
AAT_like 77..426 CDD:99734 79/375 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.