DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and ACS7

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_194350.1 Gene:ACS7 / 828726 AraportID:AT4G26200 Length:447 Species:Arabidopsis thaliana


Alignment Length:389 Identity:74/389 - (19%)
Similarity:132/389 - (33%) Gaps:105/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WNVYAPN----------ILNLGVGAPGPDILTANCDSFRTATDHCLEREKRE------------N 61
            |..|..|          ::.:|        |..|..||.....: ||::..|            .
plant    37 WKAYDENPYDESHNPSGVIQMG--------LAENQVSFDLLETY-LEKKNPEGSMWGSKGAPGFR 92

  Fly    62 QSLIFQYGPTSGTFEVRREISTYFTEMF---KSPVNCEDLIITTGASHGLHILLSTMLDFEGFVF 123
            ::.:||......||   |:....|.|..   |:..:.:.:::|.||:....:|...:.|....:.
plant    93 ENALFQDYHGLKTF---RQAMASFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALL 154

  Fly   124 VDEYTY----------------MIALDSIKHFSTVTIVPVKLNDDGVDLKDLEEKVSKRRFQSKK 172
            |....|                .|..||..||.   |.|..|.......:|...:|.        
plant   155 VPTPYYPGFDRDLRWRTGVKIVPIHCDSSNHFQ---ITPEALESAYQTARDANIRVR-------- 208

  Fly   173 KEFWGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVY--NILNYGETPTHSRLLSY 235
                |:..|.|:  ||.|.....:|...::......:..:|.|::|  ::.:..|..:.:.::..
plant   209 ----GVLITNPS--NPLGATVQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFHASEFTSVAEIVEN 267

  Fly   236 DDRNDANFAGHVISNGSFSKILG-PGVRLGWL--------EVPPRLKPILDGSGFATSGGCFNNY 291
            .|........|::.  |.||.|| ||.|:|.:        ....|:      |.|.    ..::.
plant   268 IDDVSVKERVHIVY--SLSKDLGLPGFRVGTIYSYNDNVVRTARRM------SSFT----LVSSQ 320

  Fly   292 TSGIVGSLFELKLAQKQISESY-----EAYKERMLATTQVLRDELPDCCKLVSPTGGYFIWVRI 350
            |..::.|:    |:.::.:|.|     |..:.|.....:.|:....:|.|   ...|.|.|:.:
plant   321 TQHMLASM----LSDEEFTEKYIRINRERLRRRYDTIVEGLKKAGIECLK---GNAGLFCWMNL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 72/383 (19%)
AAT_like 27..407 CDD:99734 71/371 (19%)
ACS7NP_194350.1 PLN02607 6..447 CDD:215327 74/389 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.