DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and ACS6

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_192867.1 Gene:ACS6 / 826730 AraportID:AT4G11280 Length:495 Species:Arabidopsis thaliana


Alignment Length:392 Identity:76/392 - (19%)
Similarity:140/392 - (35%) Gaps:89/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FDGGDWNVYAPN----------ILNLGVGA---------------PGPDILTANCDSFRTATDHC 53
            |||  |..|..|          ::.:|:..               |...|.|:            
plant    31 FDG--WKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLKHPEASICTS------------ 81

  Fly    54 LEREKRENQSLIFQYGPTSGTFEVRREISTYFTEMFKSPVNCE-DLIITTGASHGLHILLSTMLD 117
             |...:.:...|||  ...|..|.|:.::.:..:...:.|..: |.|:.:|.:.|.|..::..|.
plant    82 -EGVNQFSDIAIFQ--DYHGLPEFRQAVAKFMEKTRNNKVKFDPDRIVMSGGATGAHETVAFCLA 143

  Fly   118 FEGFVFVDEYTYMIALDSIKHFST-VTIVPVKLNDDG---VDLKDLE---EKVSKRRFQSKKKEF 175
            ..|..|:....|....|....:.| |.:|||..:...   :.::.||   |...|.....|    
plant   144 NPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKITVEALEAAYENARKSNIPVK---- 204

  Fly   176 WGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHSRLLSYDDRND 240
             |:..|.|:  ||.|.....|..:.:|....:....::.|::|....:|::...|.....::..|
plant   205 -GLLVTNPS--NPLGTTLDRECLKSLVNFTNDKGIHLIADEIYAATTFGQSEFISVAEVIEEIED 266

  Fly   241 AN-FAGHVISNGSFSKILG-PGVRLG--------WLEVPPRLKPILDGSGFATSGGCFNNYTSGI 295
            .| ...|::.  |.||.:| ||:|:|        .:::..::          :|.|..::.|..:
plant   267 CNRDLIHIVY--SLSKDMGLPGLRVGIVYSYNDRVVQIARKM----------SSFGLVSSQTQHL 319

  Fly   296 VGSLFELKLAQKQISESYEAYKERMLATTQVLRDELPDC-CKLVSPTGGYFIWVRIPDRLDCREF 359
            :..:..   .::.:.|.....|.|:.|....:...|... ...:....|.|:|      :|.|..
plant   320 IAKMLS---DEEFVDEFIRESKLRLAARHAEITTGLDGLGIGWLKAKAGLFLW------MDLRNL 375

  Fly   360 LK 361
            ||
plant   376 LK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 71/381 (19%)
AAT_like 27..407 CDD:99734 70/369 (19%)
ACS6NP_192867.1 PLN02450 12..435 CDD:178069 76/392 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.