DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and ACS1

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_191710.1 Gene:ACS1 / 825324 AraportID:AT3G61510 Length:488 Species:Arabidopsis thaliana


Alignment Length:462 Identity:88/462 - (19%)
Similarity:161/462 - (34%) Gaps:119/462 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FDGGDWNVYAPN----------ILNLGVGA---------------PGPDILTA-NCDSFRTATDH 52
            |.|  |..|..|          ::.:|:..               |...|.|| ..|||      
plant    27 FHG--WKAYDNNPFHPTHNPQGVIQMGLAENQLCSDLIKEWIKENPQASICTAEGIDSF------ 83

  Fly    53 CLEREKRENQSLIFQYGPTSGTFEVRREISTYFTEMFKSPVNCE-DLIITTGASHGLHILLSTML 116
                    :...:||  ...|..:.|:.|:|:........|..| :.::.:|.:.|.:..:...|
plant    84 --------SDIAVFQ--DYHGLKQFRQAIATFMERARGGRVRFEAERVVMSGGATGANETIMFCL 138

  Fly   117 DFEGFVFVDEYTYMIALDSIKHFST-VTIVPVKLNDDGVDLKDLEEKVSKRRFQSK--KKEFWGI 178
            ...|..|:....|..|.|....:.| |.|:||:.:...      ..:::|:..:|.  |.:..||
plant   139 ADPGDAFLVPTPYYAAFDRDLRWRTGVRIIPVECSSSN------NFQITKQALESAYLKAQETGI 197

  Fly   179 YYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHS-----RLLSYDDR 238
            ........||.|.....|....:|....:....:|||::|....:.|....|     :.:.|.:|
plant   198 KIKGLIISNPLGTSLDRETLESLVSFINDKQIHLVCDEIYAATVFAEPGFISVAEIIQEMYYVNR 262

  Fly   239 NDANFAGHVISNGSFSKILG-PGVRLG----WLEVPPRLKPILDGSGFATSGGCFNNYTSGIVGS 298
            :    ..|::.  |.||.:| ||.|:|    :.:|      ::..:...:|.|..::.|...:.:
plant   263 D----LIHIVY--SLSKDMGLPGFRVGVVYSYNDV------VVSCARRMSSFGLVSSQTQSFLAA 315

  Fly   299 LFE--------LKLAQKQISESYEAYKERMLATTQVLRDELPDCCKLVSPTGGYFIWVRIPDRLD 355
            :..        |....|::::.:..:.|.:        :|:...|  :....|.|:      .:|
plant   316 MLSDQSFVDNFLVEVSKRVAKRHHMFTEGL--------EEMGISC--LRSNAGLFV------LMD 364

  Fly   356 CREFLK------------YCMENHKIYFIVGTRFSADGQSGKQFFRLSIAFYPKSKLVDGARRLC 408
            .|..||            ..:...||....|:.|..   |...:||:..|...:..|.....|  
plant   365 LRHMLKDQTFDSEMALWRVIINKVKINVSPGSSFHC---SEPGWFRVCFANMDEDTLQIALER-- 424

  Fly   409 NALKDYI 415
              :||::
plant   425 --IKDFV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 83/448 (19%)
AAT_like 27..407 CDD:99734 80/429 (19%)
ACS1NP_191710.1 PLN02994 3..154 CDD:166635 27/144 (19%)
PLN02376 4..488 CDD:178004 88/462 (19%)
AAT_like 89..427 CDD:99734 73/380 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.