DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and Accsl

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001103064.1 Gene:Accsl / 690470 RGDID:1596039 Length:617 Species:Rattus norvegicus


Alignment Length:428 Identity:93/428 - (21%)
Similarity:167/428 - (39%) Gaps:107/428 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DILTA---NCDSFRTATDHCLEREKRENQSLIFQYGPTSGTFEVRREISTYFTEMFK--SPVNCE 96
            |::||   .||.      :.|:..:       .||....|...:|.|::::.|...|  :|::.|
  Rat   207 DLITARLTQCDM------NFLDEAQ-------LQYSDWKGEPSLREELASFLTHYCKAPTPLDPE 258

  Fly    97 DLIITTGASHGLHILLSTMLD-----------FEGFVFVDEYTYMIALDSIKHFSTVTIVPVKLN 150
            ::::..|.|.....|:..:.|           :.||.| ..|.|          |.|.::||.|.
  Rat   259 NVVVLNGCSSVFSSLVMVLCDPGDALLIPTPCYSGFTF-SSYLY----------SKVELIPVYLE 312

  Fly   151 DDGVDLKDLE-----EKVSKRRFQSKK--KEFWGIYYTIPTYHNPTGILFSPEVCRGIVQLARNY 208
            ....:.....     :|:.....|:||  |:..|:....|  .||.|.:::....:..:..|:.:
  Rat   313 SQVTETNKYSFQLTVDKLKLTLTQAKKKGKKVKGLVLINP--QNPLGDVYTQGSLQEYLVFAKKH 375

  Fly   209 DFLVVCDDVYNILNYGETPTHSRLLSYDDRNDANFAGHVISNGSFSKILG-PGVRLGWL-----E 267
            ...|:.|::|.:..:..|.|...:||.::..|.|.. |:|  ...||..| .|:|.|.|     |
  Rat   376 KLHVIMDEIYMLSVFEPTVTFHSILSIENLPDPNMI-HMI--WGTSKDFGMSGIRFGVLYTHNKE 437

  Fly   268 VPPRLKPILDGSGFATSGGCFNNYTSGIVGSLFELKLAQKQ------ISESYEAYKERMLATTQV 326
            |...:|      .|.     :::..|||:.......|..|:      :.:::...:|.....|::
  Rat   438 VASAMK------AFG-----YHHSVSGIIQYKLRQLLQDKEWINKVYLPKNHSRLREAYSYVTKM 491

  Fly   327 LRD-ELPDC-CKLVSPTGGYFIWVRI-----PDRLDCREFLKYCMENHKIYFIVGTRFSADGQSG 384
            |.| ::|.| |     ..|.|:|:.:     |...|..:.|....::.|:..          .||
  Rat   492 LEDLKIPFCNC-----GSGLFVWINLKAYLNPCTFDQEQILHQRFQDKKLLL----------SSG 541

  Fly   385 KQF-------FRLSIA-FYPKSKLVDGARRLCNALKDY 414
            |.|       |||..| .:|:.::..|  :.|..|.::
  Rat   542 KSFMCIEPGWFRLVFAEKHPQLQVAMG--QFCQVLAEH 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 93/426 (22%)
AAT_like 27..407 CDD:99734 91/419 (22%)
AccslNP_001103064.1 PLN02607 174..586 CDD:215327 93/428 (22%)
AAT_like 195..567 CDD:99734 90/414 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.