DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and accs

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005163034.1 Gene:accs / 541510 ZFINID:ZDB-GENE-050327-39 Length:916 Species:Danio rerio


Alignment Length:446 Identity:101/446 - (22%)
Similarity:170/446 - (38%) Gaps:97/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WNVYAPN----------ILNLGVG------------APGPDILTANCDSFRTATDHCLEREKREN 61
            :|.|..|          |:|||..            ...||:|..                    
Zfish   392 YNQYHANKHDEKSNPHGIINLGTSENKLCFDLLQKRLTRPDMLNI-------------------- 436

  Fly    62 QSLIFQYGPTSGTFEVRREISTYFTEMFKS--PVNCEDLIITTGASHGLHILLSTMLDFEGFVFV 124
            :....||....|...:|.|::.:.::...|  |:..|::::..|.......|.:|:.|.|..:.:
Zfish   437 EPAFLQYPDWKGHSFLREEVAKFLSDYCCSPKPLKPENVVVMNGCGSLFSALAATLCDPEDAILI 501

  Fly   125 DEYTYMIALDSIKHFSTVTI--VPVKLNDDGVDLKDLEEKVSKRRFQSKKKEFWGI---YYTIPT 184
            ....|.:..:.:..:|:|.:  ||:.....|.|::..:..|.|.....|:.:..|:   ...:..
Zfish   502 PSPFYGVITEDVDLYSSVKLHHVPLYSQPRGSDVRPFQLTVDKLENSLKEAKTEGLNVKALILLN 566

  Fly   185 YHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHSRLLSYDDRNDANFAGHVIS 249
            .|||.|.::|.|...|.:|.|:.:...|:.|::|.:..:||..|...:||.|...|.. ..||:.
Zfish   567 PHNPLGEVYSSEEMTGFLQFAKMHQLHVIVDEIYMLSVFGEKHTFRSVLSLDGLPDPQ-RTHVMW 630

  Fly   250 NGSFSKILGPGVRLGWLEVPPR-LKPILDGSGFATSGGCFNNYTSGIVGSLFELKLAQK------ 307
             |........|:|:|.:....: |...||      ..|||:    |:.|.. :.::||.      
Zfish   631 -GVSKDFAMAGMRVGTIYSENKDLVQALD------QLGCFH----GVPGPT-QYQMAQLLRDRDW 683

  Fly   308 QISESYEAYKERMLATTQVLRDELPDCCKLVSP----TGGYFIWVRIPDRLDCREFLK------- 361
            ..||.....|.|:....:.|.:||.   ||..|    ..|:|||.      |..:|||       
Zfish   684 LNSEFLPENKRRLKEAHKYLTEELK---KLDIPFLHRGAGFFIWA------DLSKFLKEKTFAEE 739

  Fly   362 ----YCMENHKIYFIVGTRFSADGQSGKQFFRLSIAFYPKSKLVDGARRLCNALKD 413
                .|...|::....|..||.   :...:||: |....:.||..|.:|:..||::
Zfish   740 LCVWRCFLKHRLLLSCGQAFSC---ASPGWFRI-IFTDQQHKLQLGVQRMKTALEE 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 99/440 (23%)
AAT_like 27..407 CDD:99734 94/420 (22%)
accsXP_005163034.1 Myb_DNA-bind_4 14..90 CDD:290549
Aminotran_1_2 409..772 CDD:278580 92/408 (23%)
AAT_like 410..786 CDD:99734 95/421 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.