DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and Accsl

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_011237947.1 Gene:Accsl / 381411 MGIID:3584519 Length:584 Species:Mus musculus


Alignment Length:430 Identity:94/430 - (21%)
Similarity:161/430 - (37%) Gaps:111/430 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DILTANCDSFRTATDHCLEREKRENQSLIFQYGPTSGTFEVRREISTYFTEMFK--SPVNCEDLI 99
            |::||..    |.:|..|..|.:      .||....|...:|.|::::.|...|  :|::.|:::
Mouse   209 DLITARL----TQSDMNLLDEAQ------LQYSDWKGQPFLREELASFLTHYCKAPTPLDPENVV 263

  Fly   100 ITTGASHGLHILLSTMLD-----------FEGFVFVDEYTYMIALDSIKHFSTVTIVPVKL---- 149
            :..|.|.....|...:.|           :.||||           |...:|.:.::||.|    
Mouse   264 VLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVF-----------SSHLYSKIELIPVHLESQV 317

  Fly   150 ---NDDGVDLKDLEEKVSKRRFQSKKKEFWGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFL 211
               |.|...|...:.|::..:.:.|.|:..|:....|  .||.|.:::....:..:..|:.:...
Mouse   318 PRSNLDSFQLTVDKLKLALTQAKKKAKKVKGLVLINP--QNPLGDVYTQSSLQEYLVFAKTHKLH 380

  Fly   212 VVCDDVYNILNYGETPTHSRLLSYDDRNDANFAGHVISNGSFSKILG-PGVRLGWL-----EVPP 270
            |:.|::|.:..:..:.|...:||..|..|.|.. |:|  ...||..| .|:|.|.|     ||..
Mouse   381 VIMDEIYMLSVFEPSVTFHSVLSIKDLPDPNMT-HMI--WGTSKDFGMSGIRFGVLYTHNKEVAS 442

  Fly   271 RLKPILDGSGFATSGGCFNNYTSGIVG----SLFELKLAQKQISESY---------EAYKERMLA 322
            .:|..              .|..|:.|    .|..|...::.||:.|         :||.    .
Mouse   443 AMKAF--------------GYHHGVSGITQYKLCRLLQDKEWISKVYLPKNHSRLQKAYS----Y 489

  Fly   323 TTQVLRD-ELPDCCKLVSPTGGYFIWVRI-----PDRLDCREFLKYCMENHKIYFIVGTRFSADG 381
            .|::|:| ::|    ..:...|.|:|:.:     |...|..:.|.....:.|:..          
Mouse   490 ITKILKDLKIP----FYNGGSGLFVWINLKAYLSPCTFDQEQILHQRFRDKKLLL---------- 540

  Fly   382 QSGKQF-------FRLSIAFYPKSKLVDGARRLCNALKDY 414
            .|||.:       |||..| .....|.....|.|:.|.::
Mouse   541 SSGKSYMCIEPGWFRLVFA-ETHLHLQVAMDRFCHVLAEH 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 94/428 (22%)
AAT_like 27..407 CDD:99734 91/421 (22%)
AccslXP_011237947.1 PLN02450 156..571 CDD:178069 91/420 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.