DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and CG1461

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster


Alignment Length:435 Identity:84/435 - (19%)
Similarity:149/435 - (34%) Gaps:107/435 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PN----ILNLGVGAPGPDILTANCDSFRTATDHCLEREKRENQSLIFQYGPTSGTFEVRREISTY 84
            ||    ::.|.:|.|.........|....|..|.||..|...      |..|.|....|:.::.|
  Fly   105 PNPEKPMIPLSIGDPTTFGNLKAADETMKAVLHSLESGKYNG------YASTQGHEIARKAVAKY 163

  Fly    85 FTEMFKSP---VNCEDLIITTGASHGLHILLSTMLDFEGFVFVDE------YTYMIALD-SIKHF 139
              ...:.|   ::..::::.:|.|..|...:..:.|....|.|..      ||....|| .::::
  Fly   164 --SAHQRPDGEIDANEVVLCSGCSSALEYCILALADRGQNVLVPRPGFCLYYTLAQGLDIEVRYY 226

  Fly   140 STVTIVPVKLNDD--GVDLKDLEEKVSKRRFQSKKKEFWGIYYTIPTYHNPTGILFSPEVCRGIV 202
            ..       |.|.  ..||..||..:.:...        .:....|:  ||.|.:|..:..|.::
  Fly   227 DL-------LPDQQWRADLVQLESLIDENTA--------ALLINNPS--NPCGSVFDEKHLRELI 274

  Fly   203 QLARNYDFLVVCDDVYNILNYGETPTHSRLLSYDDRNDANFAGHVISNGSFSK-ILGPGVRLGWL 266
            .:...:...::.|::|....:   |....|.......:.    .|:|.|..:| .|.||.|:||:
  Fly   275 AICERHYLPIIADEIYEHFVF---PGSKHLAVSSLTTEV----PVLSCGGLTKRFLVPGWRMGWI 332

  Fly   267 EVPPRLKPILD-------------GSGFATSGGCFN-------NYTSGIVGSLFELKLAQKQISE 311
            .|..|...:.|             ||.....|...:       :|..|::..|.         |.
  Fly   333 IVHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQSYFDGVIDVLH---------SN 388

  Fly   312 SYEAYKERMLATTQVLRDELPDCCKLVSPTGGYFIWV-----RIPDRLDCREFLKYCMENHKIYF 371
            :..|||  ||...:.|..        |.|.|..::.:     |.|:..|...|::..:....::.
  Fly   389 AMLAYK--MLKQVRGLDP--------VMPNGAMYMMIGVSIERFPEFKDDTHFVQEMVNEQSVFC 443

  Fly   372 IVGTRFSADGQSGKQFFRLSIAFYPKSKLVDGA--RRLCNALKDY 414
            :.|:.|...|     :.|:.:.       |.||  ...|:.:.::
  Fly   444 LPGSCFEYPG-----YVRIVLT-------VPGAMIEEACSRIAEF 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 83/432 (19%)
AAT_like 27..407 CDD:99734 81/419 (19%)
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 84/435 (19%)
AAT_like 112..475 CDD:99734 82/425 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.