DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and CG1640

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster


Alignment Length:452 Identity:103/452 - (22%)
Similarity:171/452 - (37%) Gaps:120/452 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNLGVGAPGPDILTAN---CD----------------SFRT----ATDHCLEREKR--------E 60
            |..||..|...::.||   |.                :|.|    :.|:..:.:||        :
  Fly   132 LEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQ 196

  Fly    61 NQSLIFQYGPTSGTFEVRREISTYFTEMFKS-PVNCEDLIITTGASHGLHILLSTMLDFE----- 119
            .|| :..|..::|...|||:::.|..:.... ..|.:|:.:|.|||.|:..:|| |::.|     
  Fly   197 GQS-VGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILS-MINAEVGCKA 259

  Fly   120 -GFVFVDEYTYMIALDSIKHFSTVTIVPVKLNDD---GVDLKDLEEKVSKRRFQSKKKEFWGIYY 180
             | |.|....|.:...:|..:. :|.|...|.::   .:|.|:|:     |.:...||.......
  Fly   260 PG-VMVPIPQYPLYSATISEYG-MTKVDYYLEEETGWSLDRKELQ-----RSYDEAKKVCNPRAL 317

  Fly   181 TIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHSRLLSYD----DRNDA 241
            .:....||||.:.:.|....|::.|.:...||:.|:||....|.:   :|:..|:.    :..|.
  Fly   318 VVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDK---NSKFWSFKKVAYEMGDP 379

  Fly   242 NFAGHVISNGSFSK-ILGP-GVRLGWLEV---PPRLKPILDGSGFATSGGCFNNYTSGIVGSLFE 301
            .....::|..|.|| .||. |:|.|::||   .|::|.:|               |..|..:|..
  Fly   380 YRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAML---------------TKSITAALCS 429

  Fly   302 LKLAQKQIS----------ESYEAYKERMLATTQVLRDELPDCCKLVSPTGGY---------FIW 347
            ....|..:|          .||:.||:........|::......|.::...||         :::
  Fly   430 TTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVF 494

  Fly   348 VRI----------------PDRLDCREFLKYCMENHKIYFIVGTRFSADGQS-GKQFFRLSI 392
            .:|                ||.....|.|    |...|..:.|:.|   ||. |...||.:|
  Fly   495 PQIEIPPKAIEAAKAKGMAPDVFYAFELL----ETSGICIVPGSGF---GQKPGTWHFRSTI 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 103/452 (23%)
AAT_like 27..407 CDD:99734 103/452 (23%)
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 103/452 (23%)
AAT_like 178..564 CDD:99734 94/406 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.