DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and Kyat1

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001013182.3 Gene:Kyat1 / 311844 RGDID:1306912 Length:457 Species:Rattus norvegicus


Alignment Length:450 Identity:102/450 - (22%)
Similarity:166/450 - (36%) Gaps:120/450 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSSQDRKLKHLFDGGDWNVYAP--------NILNLGVGAPG---PDILTANCDSFRTATDHCL 54
            |.|..|.|:|    ||.|.|::..        :::|||.|.|.   ||..|   .:|:.||    
  Rat    35 MTKRLQARRL----DGIDQNLWVEFGKLTKEYDVVNLGQGFPDFSPPDFAT---QAFQQAT---- 88

  Fly    55 EREKRENQSLIFQYGPTSGTFEVRREISTYFTEMFKSPVN-CEDLIITTGASHGLHILLSTMLDF 118
                 ....::.||....|...:...::::|.::....:: ..::::|.||...|......::| 
  Rat    89 -----SGNFMLNQYTRAFGYPPLTNVLASFFGKLLGQEMDPLTNVLVTVGAYGALFTAFQALVD- 147

  Fly   119 EGFVFVDEYTYM-IALDSIKHFST--------VTIVPV-----KL---NDDGVDLKDLEEKVSKR 166
            ||    ||...| .|.|..:..:.        ||:.|.     ||   ||..:|..:|..|    
  Rat   148 EG----DEVIIMEPAFDCYEPMTMMAGGCPVFVTLKPSPAPKGKLGASNDWQLDPAELASK---- 204

  Fly   167 RFQSKKKEFWGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHSR 231
             |..:.|     ...:.|.:||.|.:||......:..|.:.:|.:.:.|:||            :
  Rat   205 -FTPRTK-----ILVLNTPNNPLGKVFSRMELELVANLCQQHDVVCISDEVY------------Q 251

  Fly   232 LLSYDDRNDANFAG------HVISNGSFSK-ILGPGVRLGWLEVP----PRLKPILDGSGF---- 281
            .|.||.....:.|.      ..::.||..| ....|.::||:..|    ..|:.:...|.|    
  Rat   252 WLVYDGHQHVSIASLPGMWDRTLTIGSAGKSFSATGWKVGWVMGPDNIMKHLRTVHQNSIFHCPT 316

  Fly   282 ---ATSGGCFNNYTS--GIVGSLFELKLAQKQISESYEAYKERMLATTQVLRDELPDCCKLVSPT 341
               |....||.....  |...|.|      .|:.::.|..::.|:.:.|.:.      .||....
  Rat   317 QAQAAVAQCFEREQQHFGQPSSYF------LQLPQAMELNRDHMIRSLQSVG------LKLWISQ 369

  Fly   342 GGYFIWV-------RIPDRLDC------REFLKYCMENHKIYFI-VGTRFSADGQSGKQF 387
            |.||:..       ::||....      |.|.|:.::|..:..| |.|.||...|  |.|
  Rat   370 GSYFLIADISDFKSKMPDLPGAEDEPYDRRFAKWMIKNMGLVGIPVSTFFSRPHQ--KDF 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 92/417 (22%)
AAT_like 27..407 CDD:99734 92/415 (22%)
Kyat1NP_001013182.3 PRK08912 58..454 CDD:181580 92/422 (22%)
AAT_like 65..451 CDD:99734 92/415 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.