DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and Accs

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001254463.1 Gene:Accs / 311218 RGDID:1309314 Length:475 Species:Rattus norvegicus


Alignment Length:452 Identity:108/452 - (23%)
Similarity:184/452 - (40%) Gaps:79/452 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSQDRKLKHLFDGGD--WNVY----------APNILNLGVGAPGPDILTANCDSFRTATDHCLER 56
            ||:.|.:|..:|..:  :..|          ...|:|||.   ..:.|..:..|:|...:..|..
  Rat    42 SSRGRVIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGT---SENKLCFDLLSWRLTQNDMLHV 103

  Fly    57 EKRENQSLIFQYGPTSGTFEVRREISTYFTEMFKS--PVNCEDLIITTGASHGLHILLSTMLDFE 119
            |..     :.||....|...:|:|::.:.:...||  |:..|::::..|.: .|...|:|:|...
  Rat   104 EPS-----LLQYPDWRGHRFLRKEVARFLSFYCKSPAPLKPENVVVLNGCA-SLFSALATVLCEP 162

  Fly   120 GFVFVDEYTYMIAL-DSIKHFSTVTIVPVKLND--DGVDLKDLEEKVSK-----RRFQSKKKEFW 176
            |.|.:....|..|: ..|..:..:.:..|.|:.  .|::.:..:..|.|     :...|:..:..
  Rat   163 GEVLLIPTPYYGAITQHIYLYGNIRLAYVYLDSKVTGLNTRPFQLTVEKLEMALQGVNSEGVKVK 227

  Fly   177 GIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDDVYNILNYGETPTHSRLLSYDDRNDA 241
            |:....|  .||.|.::|||..:..:..|..:...|:.|:||.:..:.|:..:..:||.:...|.
  Rat   228 GLILINP--QNPLGDIYSPEELQDFLGFAMRHKLHVIMDEVYMLSVFEESLGYRSVLSLERLPDP 290

  Fly   242 NFAGHVISNGSFSKILG-PGVRLGWLEVPPRLKPILDGSGFATSGGCFNNYTSGIVGSLFELKLA 305
            . ..||:  .:.||..| .|:|.|.|        ..:....||:......| .|:.| |.:.::|
  Rat   291 Q-RTHVM--WATSKDFGMSGLRFGVL--------YTENQHVATAVASLCRY-HGLSG-LVQHQMA 342

  Fly   306 Q-----KQISESY--EAYKERMLATTQVLRDELPDCCKLVSPTGGYFIWVRIPDRLDCREFLKY- 362
            |     ..||:.|  |.:.....|.|.|..:........||...|:||||      |.|::|:. 
  Rat   343 QLLQDHDWISQVYLPENHARLKAAHTYVSEELRALGIPFVSRGAGFFIWV------DLRKYLREG 401

  Fly   363 CMENHKIYFIVGTRFSADGQ----SGKQF-------FRLSIAFYPK-SKLVDGARRLCNALK 412
            ..|...:.:   .|| .|.:    |||.|       ||  :.|..| ::|..|.:|:...||
  Rat   402 TFEEEAMLW---RRF-LDNKVLLSSGKTFECKEPGWFR--VVFSDKENRLRLGMQRMRQVLK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 102/419 (24%)
AAT_like 27..407 CDD:99734 98/410 (24%)
AccsNP_001254463.1 PLN02450 35..475 CDD:178069 108/452 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.