DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and Gpt2

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001012057.1 Gene:Gpt2 / 307759 RGDID:1305462 Length:522 Species:Rattus norvegicus


Alignment Length:450 Identity:97/450 - (21%)
Similarity:166/450 - (36%) Gaps:126/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDILTANCDSFRTATDHCLEREKRENQSL----IFQYGPTSGTFEVRREISTYFTEMFKSPVNCE 96
            |::|  |..||   .:...:|.:|..|:.    :..|..:.|...:|.:::.:.|.....|.:.:
  Rat   119 PNLL--NSPSF---PEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPD 178

  Fly    97 DLIITTGASHGLHILLSTMLDFEG------FVFVDEYTYMIA----LDSIKHFSTVTIVPVKLND 151
            ::.:|||||.|:..:|..::...|      .:.:.:|....|    ||:|:       |...|::
  Rat   179 NIYLTTGASDGISTILKLLVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQ-------VNYYLDE 236

  Fly   152 DGVDLKDLEEKVSKRRFQSKKKEFWGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDD 216
            |.....:::|  .:|..:..|.........|....||||.:.|.:....::..|......::.|:
  Rat   237 DNCWALNVDE--LRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADE 299

  Fly   217 VY--NILN------------YGETPTHSRLLSYDDRNDANFAGHVISNGSFSKILGPGVRLGWLE 267
            ||  |:.:            |...|.:|..:..     |:|  |..|.|...:.   |.|.|::|
  Rat   300 VYQDNVYSPDCRFHSFKKVLYQMGPEYSSNVEL-----ASF--HSTSKGYMGEC---GYRGGYME 354

  Fly   268 VPPRLKPILDG--------------SGFATSGGCFNNYTSGIVGSLFELKLAQKQISESYEAY-- 316
            | ..|.|.:.|              ||.|......|....|               .||:|.:  
  Rat   355 V-INLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVPG---------------EESFEQFTR 403

  Fly   317 -KERMLAT-------TQVLRDELP--DCCKLVSPTGGYFIWVRI----------------PDRLD 355
             ||.:|..       |:.|.:::|  .|..|   .|..:.:.||                ||...
  Rat   404 EKESVLGNLAKKAKLTEDLFNQVPGIQCNPL---QGAMYAFPRILIPAKAVEAAQSHKMAPDMFY 465

  Fly   356 CREFLKYCMENHKIYFIVGTRFSADGQ-SGKQFFRLSIAFYPKSKLVDGARRLCNALKDY 414
            |.:.|    |...|..:.|:.|   || .|...||::| ..|..||    :.:.:.:||:
  Rat   466 CMKLL----EETGICVVPGSGF---GQREGTYHFRMTI-LPPVEKL----KTVLHKVKDF 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 96/448 (21%)
AAT_like 27..407 CDD:99734 95/441 (22%)
Gpt2NP_001012057.1 PTZ00377 48..522 CDD:240391 97/449 (22%)
AAT_like 123..512 CDD:99734 93/441 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.