DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6321 and T04F3.1

DIOPT Version :9

Sequence 1:NP_648426.1 Gene:CG6321 / 39233 FlyBaseID:FBgn0036117 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001256363.1 Gene:T04F3.1 / 179608 WormBaseID:WBGene00011436 Length:3460 Species:Caenorhabditis elegans


Alignment Length:308 Identity:68/308 - (22%)
Similarity:125/308 - (40%) Gaps:57/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKSSQDRKLKHLF------DGGDWNVYAPNILNLGVGAPGPDI-----------LTANCD----- 44
            |..|..||||.|.      ..|..::.:.:....|:.:.|..:           |..|.|     
 Worm  3005 LDFSLTRKLKKLLVNCIREKAGSLDMVSMSSQYEGLSSRGQSLIESIDHASATFLKMNVDKYEPT 3069

  Fly    45 -------SFRTATDH-C--LEREKRENQSLIF-------QYGPTSGTFEVRREISTYFTEMFKSP 92
                   :|.||.:: |  |..::.::..|.|       :|.|..|..|.||.:..||.|...:.
 Worm  3070 RNPNGVVNFCTAENNICTPLLEDRFKHLELFFPNIEHLVRYPPAGGWPETRRVLVKYFKEFMGAG 3134

  Fly    93 VNCEDLIITTGASHGLHILLSTMLDFEGFVFVDEYTYMIALDSIKHFSTVTIVPVK--LNDDGVD 155
            |..::|::|.....|..:....:.:.:..:..:...|...:.:::..:...:|.|:  |::..:|
 Worm  3135 VTIDELVLTASTRTGYDVTSYCLFEQDDILLTNGPIYTGTISNVQEKAQCQVVCVETDLSNPRLD 3199

  Fly   156 LKDLEEKVSKRRFQSKKKEFWGIYYTIPTYHNPTGILFSPEVCRGIVQLARNYDFLVVCDD---- 216
            :|..|.:::::  .:.:....|:....|  |||.|:.|.||....:...|.:.:..||.|:    
 Worm  3200 VKMYEAELNRQ--IALENTVSGVIIVNP--HNPLGVTFPPEQVISLCNWASSKNLRVVIDEVFAN 3260

  Fly   217 -VYNILNYGETPTHSRLLSYDDRNDANFAGHVISNGSFSKILG-PGVR 262
             |::.||....|    .|||  |:..:....|....|.||..| ||::
 Worm  3261 SVFDKLNSKFRP----FLSY--RHRLHRPDSVAWLWSVSKDFGLPGLK 3302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6321NP_648426.1 AspB 25..414 CDD:223513 60/279 (22%)
AAT_like 27..407 CDD:99734 60/277 (22%)
T04F3.1NP_001256363.1 PTZ00121 <1134..1515 CDD:173412
SMC_N 1346..2197 CDD:308206
AAT_like 3076..3444 CDD:99734 55/237 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.