DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7888 and AT3G09340

DIOPT Version :9

Sequence 1:NP_648425.1 Gene:CG7888 / 39232 FlyBaseID:FBgn0036116 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_187545.2 Gene:AT3G09340 / 820090 AraportID:AT3G09340 Length:528 Species:Arabidopsis thaliana


Alignment Length:423 Identity:93/423 - (21%)
Similarity:172/423 - (40%) Gaps:81/423 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GTGILAMPNAFRNSGYITGSIG-TIVIGFICTFCIHQLVKAQYELCRRKKMPSMNYPMVAETAMG 131
            |..:|.||.|.:..|:    :| .|::.|....|...::   .:.|.........||.:.:.|.|
plant   149 GISLLTMPYAVKEGGW----LGLCILLSFAIITCYTGIL---LKRCLESSSDLRTYPDIGQAAFG 206

  Fly   132 EGPKCFRVFAPYIGTVVNTFLLIYQLGTCCV-YVVFVASNIKAIVDAVADTSIDVRL-------- 187
                       :.|.::.:.||..:|..||| |::.::.|:..:...:....:.|.|        
plant   207 -----------FTGRLIISILLYMELYVCCVEYIIMMSDNLSRVFPNITLNIVGVSLDSPQIFAI 260

  Fly   188 CMIIILLPLILINWVRNLKYLAPFSTLANAITMVSFGIICYYIFREPVTTEGKDAFGKP---SNF 249
            ...:|:||.:   |:::|..|:..|  |..:.:.....:|.: :...|...|....||.   :|.
plant   261 SATLIVLPTV---WLKDLSLLSYLS--AGGVFVSILLALCLF-WVGSVDGVGFHTGGKALDLANL 319

  Fly   250 PLFFGTVLFALEAIGVILPLENEMKTPQKFGGSCGVLNVSMVLIVFLYVGMGLFGYLNYGSAVLG 314
            |:..|...|......|:..:.:.||.|.||.   .||.:|....||.|:.:.:.||..:|.|:..
plant   320 PVAIGIFGFGFSGHAVLPSIYSSMKEPSKFP---LVLLISFGFCVFFYIAVAICGYSMFGEAIQS 381

  Fly   315 SITLNMPEHEVLSMCVKGMLAFAIYITHGLACYVAIDITWNDYV----------------AKRLG 363
            ..|||||:.               |....:|.:.|:.:....|.                ::::.
plant   382 QFTLNMPQQ---------------YTASKIAVWTAVVVPMTKYALALTPIVLGLEELMPPSEKMR 431

  Fly   364 AQRNALFWEYAVRTGLVLITFLLAVAIPNLELFISLFGALCLSALGLAFPALIQICTHWYNTKG- 427
            :...::|    ::|.|||.|.::|:..|...:..:|.|:...:.:...||.|..:..    .|| 
plant   432 SYGVSIF----IKTILVLSTLVVALTFPFFAIMGALMGSFLATLVDFIFPCLCYLSI----LKGR 488

  Fly   428 FAKVWLVLSNFVLIIVGILGLVIGTYTSLKEIV 460
            .:|..:.:..|: ||.||:....|||:::..:|
plant   489 LSKTQIGICVFI-IISGIVSGCCGTYSAIGRLV 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7888NP_648425.1 SLC5-6-like_sbd 51..453 CDD:294310 90/414 (22%)
SdaC 62..456 CDD:223884 92/417 (22%)
AT3G09340NP_187545.2 SLC5-6-like_sbd 135..507 CDD:320982 89/408 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.