DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7888 and Slc38a11

DIOPT Version :9

Sequence 1:NP_648425.1 Gene:CG7888 / 39232 FlyBaseID:FBgn0036116 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001363948.1 Gene:Slc38a11 / 362141 RGDID:1306005 Length:464 Species:Rattus norvegicus


Alignment Length:417 Identity:75/417 - (17%)
Similarity:147/417 - (35%) Gaps:116/417 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EH--PTTNSETLFHLLKGSLGTGILAMPNAFRNSGYITGSIGTIVIGFICTFCIHQLVKA----- 107
            ||  .::.|..:|:::...:|:||:.:|.:.:.:|:..|.:....:.:|..|.:..|:|.     
  Rat    29 EHGGKSSQSAAVFNVVNSVIGSGIIGLPYSMKQAGFPLGILLLFWVSYITDFSLVLLIKGGALSG 93

  Fly   108 --QYELCRRKKMP----------SMNYPMVAETAMG--EGPKCFRVFAPYIGTVVNTFLLIYQLG 158
              .|:....|...          ...||.:|..:..  .|....:||....|....::       
  Rat    94 TDSYQSLVNKTFGFPGYLLLSTLQFMYPFIAMISYNIITGDTLSKVFQRLPGVDPGSW------- 151

  Fly   159 TCCVYVVFVASNIKAIVDAVADTSIDVRLCMIIILLPLILINWVRNLKYLAPFSTLANAITMVSF 223
                   |::.:...:|..|..|            |||.|   .|::..|...|.::..:|.|..
  Rat   152 -------FISRHFIIVVSTVTCT------------LPLSL---YRDIAKLGKISFISTILTAVIL 194

  Fly   224 GIICYYIFREPVT-----------TEGKDAFGKPSNFPLFFGTVLFALEAIGVILPLENEMKTPQ 277
            |::        ||           |:....|.:|:           |::||||:           
  Rat   195 GVV--------VTRTISLGPNIPKTDNAWVFARPN-----------AIQAIGVM----------- 229

  Fly   278 KFGGSC--------------------GVLNVSMVLIVFLYVGMGLFGYLNYGSAVLGSITLNMPE 322
            .|...|                    .|::.|:::.||:.|.....||..:.....|.:..|...
  Rat   230 SFAFICHHNCFLVYGSLEEPTVAKWRRVIHTSILVSVFICVLFATCGYFTFTGFTQGDLFENYCR 294

  Fly   323 HEVLSMCVKGMLAFAIYITHGLACYVAIDITWNDYVAKRLGAQRNALFWEYAVRTGLVLITFLLA 387
            .:.|....:......:.:|:.:.|:|..::..|.:    .|...:::| ...:...:|....|::
  Rat   295 SDDLVTFGRFCYGITVILTYPIECFVTREVITNVF----FGGALSSVF-HVTLTAAIVTAATLIS 354

  Fly   388 VAIPNLELFISLFGALCLSALGLAFPA 414
            :.|..|.:.:.|.|.||.:.|....|:
  Rat   355 LLIDCLGIVLELNGVLCAAPLIFIIPS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7888NP_648425.1 SLC5-6-like_sbd 51..453 CDD:294310 74/416 (18%)
SdaC 62..456 CDD:223884 71/403 (18%)
Slc38a11NP_001363948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 2/4 (50%)
SLC5-6-like_sbd 32..420 CDD:382020 73/414 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.