DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7888 and SLC32A1

DIOPT Version :9

Sequence 1:NP_648425.1 Gene:CG7888 / 39232 FlyBaseID:FBgn0036116 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_542119.1 Gene:SLC32A1 / 140679 HGNCID:11018 Length:525 Species:Homo sapiens


Alignment Length:423 Identity:97/423 - (22%)
Similarity:178/423 - (42%) Gaps:67/423 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GTGILAMPNAFRNSGYITGSIGTIVIGFICTFCIHQ---LVKAQYELCRRKKMPSM--NYPMVAE 127
            |..:|.:|.|..:.||    :|..:|.|....|.:.   |:...||.....::..:  :|..:|.
Human   131 GMFVLGLPYAILHGGY----LGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIAN 191

  Fly   128 TAMGEGPKCFRVFAPYIGTVVNTFLLIYQLGTCCVYVVFVASNIKAIVDAVADTSIDVRLCMIII 192
            ..      |...|....|.|||...:|..:.||.:||| |:.|:  :.::.....:..:...||.
Human   192 AC------CAPRFPTLGGRVVNVAQIIELVMTCILYVV-VSGNL--MYNSFPGLPVSQKSWSIIA 247

  Fly   193 LLPLILINWVRNLKYLAPFS---TLANAITMVSFGIICYYIFREPVTTEGKD-AFGK------PS 247
            ...|:...:::|||.::.||   |||:.:  ::..:|.|.:.|      .:| |:.|      ..
Human   248 TAVLLPCAFLKNLKAVSKFSLLCTLAHFV--INILVIAYCLSR------ARDWAWEKVKFYIDVK 304

  Fly   248 NFPLFFGTVLFALEAIGVILP-LENEMKTPQKFGGSCGVLNVSMVLIVFLYVGMGLFGYLNYGSA 311
            .||:..|.::|:..: .:.|| ||..|:.|.:|  .| ::|.:.:....|.....|..||.:...
Human   305 KFPISIGIIVFSYTS-QIFLPSLEGNMQQPSEF--HC-MMNWTHIAACVLKGLFALVAYLTWADE 365

  Fly   312 VLGSITLNMPEHEVLSMCVKGMLAFAIYITHGLACYVAIDITWNDYVAKRLGAQRNALF------ 370
            ....||.|:|..  :...|...|.....:::.|..:.|:::     :.|.|..:.:..|      
Human   366 TKEVITDNLPGS--IRAVVNIFLVAKALLSYPLPFFAAVEV-----LEKSLFQEGSRAFFPACYS 423

  Fly   371 -------WEYAVRTGLVLITFLLAVAIPNLELFISLFGALCLSALGLAFPALIQICTHWYNTKGF 428
                   |...:|..||:.|.|:|:.:|:..|.:.|.|:|..:.|....|:|..:...|...   
Human   424 GDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKL--- 485

  Fly   429 AKVW-LVLSNFVLIIVGILGLVIGTYTSLKEIV 460
              :| .|..:..:.::|.:..|.|...||:.::
Human   486 --LWHQVFFDVAIFVIGGICSVSGFVHSLEGLI 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7888NP_648425.1 SLC5-6-like_sbd 51..453 CDD:294310 95/414 (23%)
SdaC 62..456 CDD:223884 95/417 (23%)
SLC32A1NP_542119.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..107
Aa_trans 115..512 CDD:279788 95/417 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158529
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.