DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43693 and Slc38a8

DIOPT Version :9

Sequence 1:NP_001261694.1 Gene:CG43693 / 39231 FlyBaseID:FBgn0263776 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001009950.1 Gene:Slc38a8 / 234788 MGIID:2685433 Length:432 Species:Mus musculus


Alignment Length:454 Identity:111/454 - (24%)
Similarity:189/454 - (41%) Gaps:81/454 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GNYNPFEH--RKVEHPT-SDLETFVHLLKGSLGSGILAMPMAFSHAGLWFGLVATFAVGTLCTYC 207
            |:..|.|.  ....||| |.|.....|||.:||:|:|..|.||..||   |::.||.|.      
Mouse     7 GSRGPLEKPLPAATHPTLSSLGAVFILLKSALGAGLLNFPWAFYKAG---GMLPTFLVA------ 62

  Fly   208 VHILVKCAHILCRRRKIPMMGF-ADVAEQAFLDG------PPALNRWSRFIRFMVNTFLVIDLLG 265
               ||....::   ..:.::|: |.|:.|....|      .||:.:... |.|:.|..:      
Mouse    63 ---LVSLVFLI---SGLVILGYAASVSGQTTYQGVVRELCGPAMGKLCE-ICFLTNLLM------ 114

  Fly   266 CCCIYLVFVATNVEQVVRV------------YMETELSIRVWIMIVTAPLIFMCLVRNLKFLTPF 318
               |.:.|:....:|:.::            |.....::.:..|:|..||..:..:...|:.:..
Mouse   115 ---ISVAFLRVIGDQLEKLCDSLLPDAPQPWYAAQNFTLPLISMLVIFPLSALREIALQKYTSIL 176

  Fly   319 SMIANILMFVGIVITFIYMFSDIPAPVERPG-IVSVTEWPLFFG---TVIFALEGIGVVMSLEND 379
            ..:|  ..::.:|||..|.... ...:.:|| ::|.:.|...|.   |:.|..:.....:|:...
Mouse   177 GTLA--ACYLALVITVQYYLWP-QGLIRQPGPLLSPSPWTSVFSVFPTICFGFQCHEAAVSIYCS 238

  Fly   380 MKNP--SHFIGCPSVLNFGMGLVIAL-YTLVGFFGFLKYGPETQASITLNLPLEDKLAQSVKLMI 441
            |.|.  ||:. ..|||:.   |...| |||.|.:|||.:|||..|.|.::.|..|......:::.
Mouse   239 MWNQSLSHWT-LVSVLSL---LACCLVYTLTGVYGFLTFGPEVSADILMSYPGNDTAIIVARVLF 299

  Fly   442 AIAIFFTFTLQFYVPVTIL---WKGLEHKIR--PEKQNISEYGLRV---FL-VLLCGGIAVALPN 497
            |::|...:.:..::..:::   ||......|  |...:.|...:|:   || |::...:|:.||:
Mouse   300 AVSIVTVYPIVLFLGRSVMQDFWKKSYWATRGPPVLADPSGPWVRLPLTFLWVVVTLTMALFLPD 364

  Fly   498 LGPFISLIGAVCLSTLGMIVPATIELAVYHEDPGYGRFNWRL--WKNSGLILFGVVGFVAGTYV 559
            |...||:||.|. |....|.|....:.....:|...|....|  |        |::..:.||::
Mouse   365 LSEIISIIGGVS-SFFIFIFPGLCLICAVDTEPMGPRVKCCLEAW--------GILSVLVGTFI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43693NP_001261694.1 SdaC 153..561 CDD:223884 108/447 (24%)
SLC5-6-like_sbd 158..562 CDD:294310 108/440 (25%)
Slc38a8NP_001009950.1 SdaC 23..429 CDD:223884 106/438 (24%)
SLC5-6-like_sbd 23..421 CDD:294310 106/438 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.