DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32079 and SLC38A1

DIOPT Version :10

Sequence 1:NP_729645.3 Gene:CG32079 / 39230 FlyBaseID:FBgn0052079 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens


Alignment Length:48 Identity:14/48 - (29%)
Similarity:21/48 - (43%) Gaps:7/48 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 RGMRVEDALMQLQVTVKRASQTVYRVIHAARANATH------NHGLDP 169
            |.:|....|..|::|....|....|:: ||..|.:.      |:||.|
Human    15 RTLRAARRLKNLELTAVEGSDVHVRML-AAPINPSDINMIQGNYGLLP 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32079NP_729645.3 SLC5-6-like_sbd 46..446 CDD:444915 14/48 (29%)
SLC38A1NP_001265319.1 SLC5-6-like_sbd 69..480 CDD:444915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.