DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32079 and F13H10.3

DIOPT Version :10

Sequence 1:NP_729645.3 Gene:CG32079 / 39230 FlyBaseID:FBgn0052079 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_741487.1 Gene:F13H10.3 / 177997 WormBaseID:WBGene00008774 Length:617 Species:Caenorhabditis elegans


Alignment Length:132 Identity:30/132 - (22%)
Similarity:51/132 - (38%) Gaps:55/132 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 VQAVLKSIKQSPKKVNLVAALVRGMRVEDA-LMQLQVTVKRASQTVYRVIHAARANATHNH---- 165
            :|:|.||:.|     |.||      ::|.: .|..|.::|.....|:.|      |..:::    
 Worm   146 LQSVDKSLDQ-----NCVA------KMEPSKCMFPQESLKNIRTPVFLV------NTAYDYWQIQ 193

  Fly   166 -GLDPDRLLVAEAFVGKGLFGKKVAYHAKGRSGIISIPRCRLTVIVRETTAEEEAEIARLKV-HN 228
             ||.||...:.|.:        |:               |||.:        :|.:.|::|| |.
 Worm   194 NGLVPDSPDLDERW--------KI---------------CRLNI--------QECDAAQMKVLHG 227

  Fly   229 FK 230
            |:
 Worm   228 FR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32079NP_729645.3 SLC5-6-like_sbd 46..446 CDD:444915 30/132 (23%)
F13H10.3NP_741487.1 SLC5-6-like_sbd 170..613 CDD:444915 20/97 (21%)

Return to query results.
Submit another query.