DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and Zbtb43

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001342539.1 Gene:Zbtb43 / 71834 MGIID:1919084 Length:504 Species:Mus musculus


Alignment Length:440 Identity:97/440 - (22%)
Similarity:142/440 - (32%) Gaps:124/440 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 IPSP-LFGYYLHTKYL---------NEVFRRRHDLYPSPLQH-----TPSS-----------IAS 347
            :|:| :..|.....:|         .||......:....|.|     :|||           :.|
Mouse   132 MPAPEIVSYLTAASFLQMWHVVDKCTEVLEGNPTVLCQKLNHGSDHQSPSSSNYNGLVESFELGS 196

  Fly   348 ETETS-PNAQERKSSSNHVLPHALLANNSPPPSLPSPPRSESSVTNNVATTTTSSTTKKRSSPKP 411
            ...|. |.|||.:...|.        ..|....|      .|.||.:....:.|||...|.|.:.
Mouse   197 GGHTDFPKAQELRDGENE--------EESTKDEL------SSQVTEHEYLPSNSSTEHDRLSTEM 247

  Fly   412 KGKKGEKKPMPPPQ---ERPLDLCMRNEVEPKKYKKSGSKSSLESRSAGMMPPPPALSAASSLES 473
            ..:.||:......:   .|||            |    ||.|:.:....:...|..|..|  .:.
Mouse   248 ASQDGEEGTNDSTEFHYTRPL------------Y----SKPSIMAHRRWIHVKPERLEQA--WDG 294

  Fly   474 MSALSPASSSHSGHMPITSAATPNHQPPPNSPYANAMNAAHAAAAAAAAAMI-----KMEMPLHP 533
            |.               ..||...||...:   .|.|...|:|..:.|....     |:|:....
Mouse   295 MD---------------VHAAYDEHQVTES---VNTMQTDHSAQPSGAEEEFQIVEKKVEVEFDE 341

  Fly   534 LHHQQMHHSQVPTTTVGVPVIKGDVASPTT---KETVA----WRYNLDVSPVVEEMPPGSDVAYV 591
            ......:..||......:....|:......   |:..|    :..|::::..::|.         
Mouse   342 QAEGSSYDEQVDFYGSSMEEFSGEKLGGNLIGHKQEAALAAGYSENIEMAMGIKEE--------- 397

  Fly   592 CPTCGQMFSLHDRLAKHMASRHKSRNPANDIAKAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTC 656
                          |.|:..      .|.|  |.|.|. |.:||.......|||.:|.|::||.|
Mouse   398 --------------ASHLGF------SATD--KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGC 439

  Fly   657 KVCGQVFSRSDHLSTHQRTHTGEKPYKCPQCPYAACRRDMITRHMRTHTR 706
            .|||:.|....||..|.:.|||.|||:|..|......||...||:.:.|:
Mouse   440 SVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTK 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856
C2H2 Zn finger 592..613 CDD:275368 2/20 (10%)
COG5048 607..>687 CDD:227381 31/79 (39%)
zf-C2H2 626..648 CDD:278523 8/21 (38%)
C2H2 Zn finger 628..648 CDD:275368 7/19 (37%)
zf-H2C2_2 640..665 CDD:290200 12/24 (50%)
C2H2 Zn finger 656..676 CDD:275368 8/19 (42%)
zf-H2C2_2 668..690 CDD:290200 11/21 (52%)
C2H2 Zn finger 684..704 CDD:275368 6/19 (32%)
Zbtb43NP_001342539.1 BTB 60..160 CDD:306997 5/27 (19%)
C2H2 Zn finger 413..431 CDD:275368 6/18 (33%)
C2H2 Zn finger 439..459 CDD:275368 8/19 (42%)
zf-H2C2_2 451..474 CDD:316026 11/22 (50%)
C2H2 Zn finger 467..484 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.