DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment klu and Zfp740

DIOPT Version :9

Sequence 1:	NP_001261690.1	Gene:	klu / 39228	FlyBaseID:	FBgn0013469	Length:	818	Species:	Drosophila melanogaster
Sequence 2:	NP_001276619.1	Gene:	Zfp740 / 68744	MGIID:	1915994	Length:	205	Species:	Mus musculus

Alignment Length:	136	Identity:	44/136 - (32%)
Similarity:	57/136 - (41%)	Gaps:	30/136 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   595 CGQMFSLHDRLAKHMASRHKSRNPAND----------------------------IAKAYSCDVC 631
            |...|.|..:  .|.....||||...|                            |.|.:.|:.|
Mouse    56 CKPRFDLSSK--GHRKDSDKSRNRKEDDSLAEASHSKKTVKKVVVVEQNGSFQVKIPKNFICEHC 118

  Fly   632 RRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGEKPYKCPQCPYAACRRDM 696
            ..:|..|..|.||:.:|||.||:.|.||...|.:..||..|:|.|:|||||:|.:|.....|.|.
Mouse   119 FGAFRSSYHLKRHVLIHTGEKPFECDVCDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDR 183

  Fly   697 ITRHMR 702
            :.||.|
Mouse   184 LLRHKR 189

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
klu	NP_001261690.1	FYDLN_acid	<182..248	CDD:302856
		C2H2 Zn finger	592..613	CDD:275368	4/17 (24%)
		COG5048	607..>687	CDD:227381	35/107 (33%)
		zf-C2H2	626..648	CDD:278523	7/21 (33%)
		C2H2 Zn finger	628..648	CDD:275368	7/19 (37%)
		zf-H2C2_2	640..665	CDD:290200	12/24 (50%)
		C2H2 Zn finger	656..676	CDD:275368	8/19 (42%)
		zf-H2C2_2	668..690	CDD:290200	12/21 (57%)
		C2H2 Zn finger	684..704	CDD:275368	7/19 (37%)
Zfp740	NP_001276619.1	C2H2 Zn finger	115..135	CDD:275368	7/19 (37%)
		zf-H2C2_2	127..152	CDD:290200	12/24 (50%)
		C2H2 Zn finger	143..163	CDD:275368	8/19 (42%)
		zf-H2C2_2	155..180	CDD:290200	12/24 (50%)
		C2H2 Zn finger	171..189	CDD:275368	6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167841497
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930