DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and Zscan4f

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001103786.2 Gene:Zscan4f / 665902 MGIID:3708485 Length:506 Species:Mus musculus


Alignment Length:532 Identity:108/532 - (20%)
Similarity:165/532 - (31%) Gaps:190/532 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 DLYPSPLQHTPSSI-----ASETETSPNAQERKSSSNHVLPHALLANNSPPPSLPSPPRSESSVT 391
            ||..:.|:.||:..     |.:...||:||...|.||:                           
Mouse    10 DLQTNNLEFTPTDSSGVQWAEDISNSPSAQLNFSPSNN--------------------------- 47

  Fly   392 NNVATTTTSSTTKKRSS---PKPKGKKGEKKPMPPPQERPLDLCMRNEVEPKKYKKSGS--KSSL 451
            ...||....|..|..:|   |:.:.|:.....:...|......|.......:|:|.|||  :..:
Mouse    48 GCWATQELQSLWKMFNSWLQPEKQTKEQMISQLVLEQFLLTGHCKDKYALTEKWKASGSDMRRFM 112

  Fly   452 ESRSAGMMPPPPALSAASSLESMSALSPASSSHSGHMPI------------TSAATPNHQPPP-- 502
            ||.:...:.||..:..  |::...||      .|.:||:            .:..||:::..|  
Mouse   113 ESLTDECLKPPVMVHV--SMQGQEAL------FSENMPLKEVIKLLKQQQSATRPTPDNEQMPVD 169

  Fly   503 -------------------NSPYANAMNAAHAAAAAAAAAMIKMEMPLHPLHHQ----------- 537
                               ||..|...|...:.:.....:::.|:...||.|.:           
Mouse   170 TTQDRLLATGQENSENECNNSCNATEANVGESCSGNEMDSLLIMQKEQHPEHEEGNVVCQFPHGA 234

  Fly   538 -------QMHHSQVPT--TTVGVPV-----------IKGDVAS--PTTKETVAWRYNLDVSP--- 577
                   ..||...|:  ||..||:           |..|..:  .|::......|:.|..|   
Mouse   235 RRASQGTPSHHVDFPSAPTTADVPMEEQPKDLSRENISEDKNNCYNTSRNAATQVYSGDNIPRNK 299

  Fly   578 ---------VVEEMPPGSDVAYVCP-----------TC-----GQMFSLHD-RLAKHMASR---- 612
                     :....|...|:.|..|           ||     |:.||..| |....:.||    
Mouse   300 SDSLFINKRIYHPEPEVGDIPYGVPQDSTRASQGTSTCLQESLGECFSEKDPREVPGLQSRQEQL 364

  Fly   613 ----------HKSRNPAND-------IAKAYSCDVCRRSFARSDMLTRHMR-------------- 646
                      |::..|...       .||.|.|:.|.|.|..:..|:.|.|              
Mouse   365 ISDPVLLGKNHEANLPCESHQKRFCRDAKLYKCEECSRMFKHARSLSSHQRTHLNKKSELLCVTC 429

  Fly   647 ---------------LHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGEKPYKCPQCPYAACRRDM 696
                           :|...||:.|..|.:.||...:|.:|:..||||.||.|..|.....:...
Mouse   430 QKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSST 494

  Fly   697 ITRHMRTHTRYD 708
            ..||:|.:.|.|
Mouse   495 YHRHLRNYHRSD 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856
C2H2 Zn finger 592..613 CDD:275368 10/51 (20%)
COG5048 607..>687 CDD:227381 30/129 (23%)
zf-C2H2 626..648 CDD:278523 8/50 (16%)
C2H2 Zn finger 628..648 CDD:275368 7/48 (15%)
zf-H2C2_2 640..665 CDD:290200 9/53 (17%)
C2H2 Zn finger 656..676 CDD:275368 6/19 (32%)
zf-H2C2_2 668..690 CDD:290200 10/21 (48%)
C2H2 Zn finger 684..704 CDD:275368 5/19 (26%)
Zscan4fNP_001103786.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 5/13 (38%)
SCAN <51..117 CDD:295388 16/65 (25%)
zf-C2H2 395..417 CDD:278523 8/21 (38%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
C2H2 Zn finger 426..446 CDD:275368 0/19 (0%)
zf-H2C2_2 438..463 CDD:290200 6/24 (25%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
zf-H2C2_2 466..491 CDD:290200 10/24 (42%)
C2H2 Zn finger 482..500 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.