DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and Zscan4b

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001172102.1 Gene:Zscan4b / 665780 MGIID:3645447 Length:505 Species:Mus musculus


Alignment Length:531 Identity:106/531 - (19%)
Similarity:161/531 - (30%) Gaps:189/531 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 DLYPSPLQHTPSSI-----ASETETSPNAQERKSSSNHVLPHALLANNSPPPSLPSPPRSESSVT 391
            ||..:.|:.||:..     |.:...||:||...|.||:                           
Mouse    10 DLQTNNLEFTPTDSSGVQWAEDISNSPSAQLNFSPSNN--------------------------- 47

  Fly   392 NNVATTTTSSTTKKRSS---PKPKGKKGEKKPMPPPQERPLDLCMRNEVEPKKYKKSGS--KSSL 451
            ...||....|..|..:|   |:.:.|:.....:...|......|.......:|:|.|||  :..:
Mouse    48 GCWATQELQSLWKMFNSWLQPEKQTKEQMISQLVLEQFLLTGHCKDKYALTEKWKASGSDMRRFM 112

  Fly   452 ESRSAGMMPPPPALSAASSLESMSALSPASSSHSGHMPI----------TSAATP---NHQPPPN 503
            ||.:...:.||..:..  |::...||      .|.:||:          .||..|   |.|.|.:
Mouse   113 ESLTDECLKPPVMVHV--SMQGQEAL------FSENMPLKEVIKLLKQQQSATRPIPDNAQMPVD 169

  Fly   504 --------------------SPYANAMNAAHAAAAAAAAAMIKMEMPLHPLHHQ----------- 537
                                |..|..:|...:.:.....:::..:...:..|.:           
Mouse   170 TTQDRLLATGQENSENECNTSCNATEVNVGESCSGNEKDSLLITQKEQNHEHEEGNVVCQFPRGA 234

  Fly   538 -------QMHHSQVPT--TTVGVPV-----------IKGDVAS--PTTKETVAWRYNLDVSP--- 577
                   ..||...|:  |...||:           |..|..:  .|::......|:.|..|   
Mouse   235 RRASQDTSSHHVDFPSALTPADVPMEEQPMDLSRENISEDKNNCYNTSRNAATQVYSGDNIPRNK 299

  Fly   578 ---------VVEEMPPGSDVAYVCP-----------TC-----GQMFSLHD-RLAKHMASR---- 612
                     :....|...|:.|..|           ||     |:.||..| |....:.||    
Mouse   300 TDSLFINKRIYHPEPEVGDIPYGVPQDSTRASQGTSTCLQESLGECFSEKDPREVPGLQSRQEQP 364

  Fly   613 ---------HKSRNPAND-------IAKAYSCDVCRRSFARSDMLTRHMR--------------- 646
                     |::..|...       .||.|.|:.|.|.|..:..|:.|.|               
Mouse   365 ISDPVLGKNHEANLPCESHQKRFHRDAKLYKCEECSRMFKHARSLSSHQRTHLNKKSELLCITCQ 429

  Fly   647 --------------LHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGEKPYKCPQCPYAACRRDMI 697
                          :|...||:.|..|.:.||...:|..|:..||||.||.|..|.....:....
Mouse   430 KIFKRVSDLRTHEIIHMSEKPFKCSTCEKSFSHKTNLKYHEMIHTGEMPYVCSLCSRRFRQSSTY 494

  Fly   698 TRHMRTHTRYD 708
            .||:|.:.|.|
Mouse   495 HRHLRNYHRSD 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856
C2H2 Zn finger 592..613 CDD:275368 10/50 (20%)
COG5048 607..>687 CDD:227381 30/128 (23%)
zf-C2H2 626..648 CDD:278523 8/50 (16%)
C2H2 Zn finger 628..648 CDD:275368 7/48 (15%)
zf-H2C2_2 640..665 CDD:290200 9/53 (17%)
C2H2 Zn finger 656..676 CDD:275368 6/19 (32%)
zf-H2C2_2 668..690 CDD:290200 10/21 (48%)
C2H2 Zn finger 684..704 CDD:275368 5/19 (26%)
Zscan4bNP_001172102.1 SCAN <51..117 CDD:295388 16/65 (25%)
zf-C2H2 394..416 CDD:278523 8/21 (38%)
C2H2 Zn finger 396..416 CDD:275368 7/19 (37%)
C2H2 Zn finger 425..445 CDD:275368 0/19 (0%)
zf-H2C2_2 437..462 CDD:290200 6/24 (25%)
zf-CHCC <441..489 CDD:295045 17/47 (36%)
C2H2 Zn finger 453..473 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..499 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.