DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and ZSCAN2

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_024305746.1 Gene:ZSCAN2 / 54993 HGNCID:20994 Length:645 Species:Homo sapiens


Alignment Length:616 Identity:129/616 - (20%)
Similarity:189/616 - (30%) Gaps:174/616 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 KAEPMEMKGDLAEDAEQDEDHDGS--------------------------------VPDEEDDSV 209
            :.|..|....|.||..|.....||                                :..|..::.
Human   114 RPESSEEAAALVEDLTQTLQDSGSQRVHQPFSVLTVCKVSSRSARRALELHLNYFEIQSENGENC 178

  Fly   210 DQD--GDAGKYIKSEQPVSE-----DEENEQEMDQDIEDISGEDLELSHSDDNDQDDSPRISMSP 267
            :||  .:..:.|.||.|..|     |.|::.|.|..|:.:.|      ||...|           
Human   179 NQDMFENESRKIFSEMPEGESAQHSDGESDFERDAGIQRLQG------HSPGED----------- 226

  Fly   268 LQLQAAQSNLPQDQNQPMNKENPLHVDIKTEIPSPYDRYFPIPSPLFGYYLHTK-----YLNEVF 327
                                    |.::.::     ||.......|.|.||..|     ...:.|
Human   227 ------------------------HGEVVSQ-----DREVGQLIGLQGTYLGEKPYECPQCGKTF 262

  Fly   328 RRRHDLYPSPLQHTPSSIASETETSPNAQERKSSSNH------------------------VLPH 368
            .|:..|......||........|...:..:..:.|.|                        ::.|
Human   263 SRKSHLITHERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCRDCGKSFSRSANLITH 327

  Fly   369 ALLANNSPPPSLPSPPRSESSVTNNVATTTTSSTTKKRSSPKPKGKKGEKKPMPPPQERPLDLCM 433
            ..:.....|.......:|.|...|.:|...|.:..|..|.|:.....|.:..:...|.      :
Human   328 QRIHTGEKPFQCAECGKSFSRSPNLIAHQRTHTGEKPYSCPECGKSFGNRSSLNTHQG------I 386

  Fly   434 RNEVEPKKYKKSGSKSSLES------RSAGMMPPPPALSAASSLESMSALSPASSSHSGHMPI-- 490
            ....:|.:.|:.|...|..|      |......|.............|||.....:|:|..|.  
Human   387 HTGEKPYECKECGESFSYNSNLIRHQRIHTGEKPYKCTDCGQRFSQSSALITHRRTHTGEKPYQC 451

  Fly   491 ----------TSAATPNHQPPPNSPYANAMNAAHAAAAAAAAAMIKMEMPLHPLHHQQMHHSQVP 545
                      ::.||.........||...:.....:.:::..|            ||.||..:.|
Human   452 SECGKSFSRSSNLATHRRTHMVEKPYKCGVCGKSFSQSSSLIA------------HQGMHTGEKP 504

  Fly   546 TTTVGVPVIKGDVASPTTKETVAWRYNLDVSPVVEEMPPGSDVAYVCPTCGQMFSLHDRLAKHMA 610
            ...:            |..|:.:|..||    :..:.....:..|.|..||:.||...:|..|..
Human   505 YECL------------TCGESFSWSSNL----LKHQRIHTGEKPYKCSECGKCFSQRSQLVVHQR 553

  Fly   611 SRHKSRNPANDIAKAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQRT 675
            : |....|       |.|.:|.:||:|..:|..|.|.|.|.|||.|..||:.||.:..|..|||.
Human   554 T-HTGEKP-------YKCLMCGKSFSRGSILVMHQRAHLGDKPYRCPECGKGFSWNSVLIIHQRI 610

  Fly   676 HTGEKPYKCPQCPYAACRRDMITRHMRTHTR 706
            ||||||||||:|............|.|||.:
Human   611 HTGEKPYKCPECGKGFSNSSNFITHQRTHMK 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856 21/104 (20%)
C2H2 Zn finger 592..613 CDD:275368 7/20 (35%)
COG5048 607..>687 CDD:227381 36/79 (46%)
zf-C2H2 626..648 CDD:278523 9/21 (43%)
C2H2 Zn finger 628..648 CDD:275368 8/19 (42%)
zf-H2C2_2 640..665 CDD:290200 12/24 (50%)
C2H2 Zn finger 656..676 CDD:275368 9/19 (47%)
zf-H2C2_2 668..690 CDD:290200 15/21 (71%)
C2H2 Zn finger 684..704 CDD:275368 5/19 (26%)
ZSCAN2XP_024305746.1 SCAN 70..157 CDD:322011 8/42 (19%)
COG5048 251..631 CDD:227381 93/421 (22%)
C2H2 Zn finger 255..275 CDD:275368 3/19 (16%)
C2H2 Zn finger 283..303 CDD:275368 3/19 (16%)
C2H2 Zn finger 311..331 CDD:275368 1/19 (5%)
C2H2 Zn finger 339..359 CDD:275368 4/19 (21%)
C2H2 Zn finger 367..387 CDD:275368 3/25 (12%)
C2H2 Zn finger 395..415 CDD:275368 5/19 (26%)
C2H2 Zn finger 423..443 CDD:275368 3/19 (16%)
C2H2 Zn finger 451..471 CDD:275368 2/19 (11%)
C2H2 Zn finger 479..499 CDD:275368 3/31 (10%)
C2H2 Zn finger 507..527 CDD:275368 5/35 (14%)
C2H2 Zn finger 535..555 CDD:275368 7/20 (35%)
C2H2 Zn finger 563..583 CDD:275368 8/19 (42%)
C2H2 Zn finger 591..611 CDD:275368 9/19 (47%)
C2H2 Zn finger 619..639 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.