DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and sqz

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster


Alignment Length:189 Identity:61/189 - (32%)
Similarity:85/189 - (44%) Gaps:33/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 MEMPLHP-------LHH--QQMHHSQVPTTTVGVPVIKGDVASPTTKETVAWRYNLDVSPVVEEM 582
            ||...||       |||  ||.|..|:..:      .....:.||..|....:|:.:.||..::|
  Fly    72 MEQQPHPDQQQQQHLHHPQQQQHPPQLKVS------YSAPNSPPTPHEQQEQKYDPNRSPPRQQM 130

  Fly   583 PPGSDVAYVCPTCGQMFSLHDRLAKHMASRHKSRNPANDIAKAYSCDVCRRSFARSDMLTRHMRL 647
            ...|...                :...:...:||....|.||.|.|..|.:|||.|..|::|.|:
  Fly   131 SSASGSG----------------SNGSSPEEESRRGDGDQAKPYKCGSCSKSFANSSYLSQHTRI 179

  Fly   648 HTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGEKPYKCPQ--CPYAACRRDMITRHMRTH 704
            |.|:|||.|::|.:.|::..||..|.|||||:|||||..  ||.|..:...:..|.|.|
  Fly   180 HLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856
C2H2 Zn finger 592..613 CDD:275368 0/20 (0%)
COG5048 607..>687 CDD:227381 36/81 (44%)
zf-C2H2 626..648 CDD:278523 10/21 (48%)
C2H2 Zn finger 628..648 CDD:275368 9/19 (47%)
zf-H2C2_2 640..665 CDD:290200 11/24 (46%)
C2H2 Zn finger 656..676 CDD:275368 7/19 (37%)
zf-H2C2_2 668..690 CDD:290200 15/23 (65%)
C2H2 Zn finger 684..704 CDD:275368 6/21 (29%)
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 9/19 (47%)
zf-H2C2_2 172..197 CDD:290200 11/24 (46%)
zf-C2H2 186..208 CDD:278523 8/21 (38%)
C2H2 Zn finger 188..208 CDD:275368 7/19 (37%)
zf-C2H2_8 191..271 CDD:292531 21/48 (44%)
zf-H2C2_2 200..227 CDD:290200 16/26 (62%)
C2H2 Zn finger 216..238 CDD:275368 6/21 (29%)
C2H2 Zn finger 246..266 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.