DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment klu and CG14711

DIOPT Version :9

Sequence 1:	NP_001261690.1	Gene:	klu / 39228	FlyBaseID:	FBgn0013469	Length:	818	Species:	Drosophila melanogaster
Sequence 2:	NP_650094.1	Gene:	CG14711 / 41395	FlyBaseID:	FBgn0037922	Length:	377	Species:	Drosophila melanogaster

Alignment Length:	137	Identity:	50/137 - (36%)
Similarity:	71/137 - (51%)	Gaps:	20/137 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   580 EEMPP----------GSDVAYVCPTCGQMFSLHDRLAKHMASRHKSRNPANDIAKAYSCDVCRRS 634
            ||.||          .|....:|..||.::|....|..|| .||.:..|       :.|::|.:|
  Fly   206 EERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHM-RRHMAEKP-------FKCEICSKS 262

  Fly   635 FARSDMLTRHMRLHTGVKPYTCKVCGQVFS-RSDHLSTHQRTHTGEKPYKCPQCPYAACRRDMIT 698
            ||....|.||:|:|||.||:.||.|.:.|: ||.:: .|:||||.|:|:.|..|..|....:::.
  Fly   263 FAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNI-RHERTHTNERPFTCSTCGKAFSYSNVLK 326

  Fly   699 RHMRTHT 705
            .||.|||
  Fly   327 NHMLTHT 333

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
klu	NP_001261690.1	FYDLN_acid	<182..248	CDD:302856
		C2H2 Zn finger	592..613	CDD:275368	7/20 (35%)
		COG5048	607..>687	CDD:227381	33/80 (41%)
		zf-C2H2	626..648	CDD:278523	9/21 (43%)
		C2H2 Zn finger	628..648	CDD:275368	9/19 (47%)
		zf-H2C2_2	640..665	CDD:290200	13/25 (52%)
		C2H2 Zn finger	656..676	CDD:275368	8/20 (40%)
		zf-H2C2_2	668..690	CDD:290200	9/21 (43%)
		C2H2 Zn finger	684..704	CDD:275368	5/19 (26%)
CG14711	NP_650094.1	zf-AD	6..81	CDD:285071
		C2H2 Zn finger	228..248	CDD:275368	7/20 (35%)
		zf-H2C2_2	240..264	CDD:290200	9/31 (29%)
		COG5048	249..>362	CDD:227381	36/93 (39%)
		C2H2 Zn finger	256..276	CDD:275368	9/19 (47%)
		zf-H2C2_2	268..292	CDD:290200	12/23 (52%)
		C2H2 Zn finger	284..304	CDD:275368	8/20 (40%)
		zf-H2C2_2	299..321	CDD:290200	10/21 (48%)
		C2H2 Zn finger	312..332	CDD:275368	5/19 (26%)
		zf-H2C2_2	325..349	CDD:290200	5/9 (56%)
		C2H2 Zn finger	340..362	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24381
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100