DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and ZBTB7C

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_016881094.1 Gene:ZBTB7C / 201501 HGNCID:31700 Length:668 Species:Homo sapiens


Alignment Length:544 Identity:121/544 - (22%)
Similarity:175/544 - (32%) Gaps:190/544 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 EPMEMKGDLAEDAEQDEDHDGSVPDEEDDSVDQDGDAGKYIKSEQPVSEDEENEQEMDQDIEDIS 243
            |.||..||..|:.::::|.|    ||:||             .|:...|:||.|::.|.|.||.:
Human   174 EIMEPGGDGGEEDDKEDDDD----DEDDD-------------DEEDEEEEEEEEEDDDDDTEDFA 221

  Fly   244 GEDLELSHSDDNDQDDSPRISMSPLQLQAAQSNLPQDQNQPMNKENPLHVDIKTEIPSPYDRYFP 308
            .:: .|....|.....||  |.:....:.|.|:.|:|........:|.|:.:        .|.|.
Human   222 DQE-NLPDPQDISCHQSP--SKTDHLTEKAYSDTPRDFPDSFQAGSPGHLGV--------IRDFS 275

  Fly   309 IPSPLFGYYLHTKYLNEVFRRRHDLYPSPLQHTPSSIASETETSPNAQERKSS----SNHVLPHA 369
            |.|.|                |.:|||                ..|..:|:.|    :....||.
Human   276 IESLL----------------RENLYP----------------KANIPDRRPSLSPFAPDFFPHL 308

  Fly   370 LLANNSPPPSLPSPPRSESSVTNNVATTTTSSTTKKRSSPKPKGKKGEKKPMPPPQERPLDLCMR 434
            ...:......||..|.....:         ....|.|     |.|:.||:.:|||...|.     
Human   309 WPGDFGAFAQLPEQPMDSGPL---------DLVIKNR-----KIKEEEKEELPPPPPPPF----- 354

  Fly   435 NEVEPKKYKKSGSKSSLESRSAGMMPPPPALSAASSLESMSALSPASSSHSGHMPITSAATPNHQ 499
                |..:.|.            |.|..|.          ..|.|..:.:.              
Human   355 ----PNDFFKD------------MFPDLPG----------GPLGPIKAEND-------------- 379

  Fly   500 PPPNSPYANAMNAAHAAAAAAAAAMIKMEMPLHPLHHQQMHHSQVPTTTVGVPVIKGDVASPTTK 564
               ...|.|.::|.|.                                        |.:..|   
Human   380 ---YGAYLNFLSATHL----------------------------------------GGLFPP--- 398

  Fly   565 ETVAWRYNLDVSPVVEEMPPGSDVAYVCPTCGQMFSLHDRLAKHMASRHKSRNPANDIAKAYSCD 629
                |       |:|||.......:..||.|.::.....:|.:||.: |....|       |.|.
Human   399 ----W-------PLVEERKLKPKASQQCPICHKVIMGAGKLPRHMRT-HTGEKP-------YMCT 444

  Fly   630 VCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGEKPYKCPQCPYAACRR 694
            :|...|.|.|.|..|||.|||.:||.|..|...|..:..|..|.|.|||.:||:|..|..:..|.
Human   445 ICEVRFTRQDKLKIHMRKHTGERPYLCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRS 509

  Fly   695 DMITRHMRTHTRYDSRGGSREGRE 718
            |.:.||::..:...:|  .|.||:
Human   510 DHLHRHIKRQSCRMAR--PRRGRK 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856 19/65 (29%)
C2H2 Zn finger 592..613 CDD:275368 6/20 (30%)
COG5048 607..>687 CDD:227381 31/79 (39%)
zf-C2H2 626..648 CDD:278523 10/21 (48%)
C2H2 Zn finger 628..648 CDD:275368 9/19 (47%)
zf-H2C2_2 640..665 CDD:290200 12/24 (50%)
C2H2 Zn finger 656..676 CDD:275368 6/19 (32%)
zf-H2C2_2 668..690 CDD:290200 10/21 (48%)
C2H2 Zn finger 684..704 CDD:275368 6/19 (32%)
ZBTB7CXP_016881094.1 BTB 73..176 CDD:279045 1/1 (100%)
BTB 84..177 CDD:197585 1/2 (50%)
C2H2 Zn finger 415..435 CDD:275368 6/20 (30%)
zf-H2C2_2 430..452 CDD:290200 8/29 (28%)
C2H2 Zn finger 443..463 CDD:275368 9/19 (47%)
zf-H2C2_2 456..480 CDD:290200 12/23 (52%)
C2H2 Zn finger 471..491 CDD:275368 6/19 (32%)
zf-H2C2_2 483..508 CDD:290200 10/24 (42%)
C2H2 Zn finger 499..517 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4723
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.