DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and ZNF367

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_710162.1 Gene:ZNF367 / 195828 HGNCID:18320 Length:350 Species:Homo sapiens


Alignment Length:441 Identity:103/441 - (23%)
Similarity:156/441 - (35%) Gaps:164/441 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 ALLANNSPPPSLP------SPPRSESSVTNNVATTTTSSTTKKRSSPKPKGKKGEKKPMPP--PQ 425
            |.:|.|.|||..|      ||.|...||   :.||....|.         |..||.:|.||  |.
Human     7 APMAENPPPPPPPVIFCHDSPKRVLVSV---IRTTPIKPTC---------GGGGEPEPPPPLIPT 59

  Fly   426 ERPLDLCMRNEVEPKKYKKSGSKSSLESRSAGMMPPPPALSAASSLESMSALSPASSSHSGHMPI 490
            .......|   |.|.::.::....:|.         |.|..||:|....:|   |::.|||    
Human    60 SPGFSDFM---VYPWRWGENAHNVTLS---------PGAAGAAASAALPAA---AAAEHSG---- 105

  Fly   491 TSAATPNHQPPPNSPYANAMNAAHAAAAAAAAAMIKMEMPLHPLHHQQMHHSQVPTTTVGVPVIK 555
               ......|||            ||:|:|||:..:.|                           
Human   106 ---LRGRGAPPP------------AASASAAASGGEDE--------------------------- 128

  Fly   556 GDVASPTTKETVAWRYNLDVSPVVEEMPPGSDVAYVCPTCGQMFSLHDRL--AKHMASRHKSRNP 618
            .:.:||.:..         :...:....|.:|            ::.|.:  .:|.:||.:    
Human   129 EEASSPDSGH---------LKDGIRRGRPRAD------------TVRDLINEGEHSSSRIR---- 168

  Fly   619 ANDIAKAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKV--CGQVFSRSDHLSTHQRTHTGEKP 681
                     |::|.|.|.|...|..|.|.|||.:||.|..  ||:.|.:|..|.||||.||||||
Human   169 ---------CNICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKP 224

  Fly   682 Y----------------KCPQCPYAACRRDMITRHMRTHTRYDSRGGSR------EGREGR---- 720
            :                .||:.|||..:|:..|..:..|...|::..:.      |.||.|    
Human   225 FVCSENGCLSRFTHANRHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWEMREQRTPTL 289

  Fly   721 EGR-----------------EGKESRDSRRSNERIEEPNS--PGSHSLLDM 752
            :|:                 ..:|..:.|.:..|::|...  .|:.:|:::
Human   290 KGKLVQKADQEQQDPLEYLQSDEEDDEKRGAQRRLQEQRERLHGALALIEL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856
C2H2 Zn finger 592..613 CDD:275368 3/22 (14%)
COG5048 607..>687 CDD:227381 34/97 (35%)
zf-C2H2 626..648 CDD:278523 8/21 (38%)
C2H2 Zn finger 628..648 CDD:275368 8/19 (42%)
zf-H2C2_2 640..665 CDD:290200 12/26 (46%)
C2H2 Zn finger 656..676 CDD:275368 10/21 (48%)
zf-H2C2_2 668..690 CDD:290200 14/37 (38%)
C2H2 Zn finger 684..704 CDD:275368 7/19 (37%)
ZNF367NP_710162.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..151 15/101 (15%)
COG5048 167..>240 CDD:227381 29/85 (34%)
zf-C2H2 168..189 CDD:278523 8/33 (24%)
C2H2 Zn finger 169..189 CDD:275368 8/19 (42%)
zf-H2C2_2 181..208 CDD:290200 12/26 (46%)
C2H2 Zn finger 197..219 CDD:275368 10/21 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..327 4/36 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.