DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment klu and odd-2

DIOPT Version :9

Sequence 1:	NP_001261690.1	Gene:	klu / 39228	FlyBaseID:	FBgn0013469	Length:	818	Species:	Drosophila melanogaster
Sequence 2:	NP_509032.1	Gene:	odd-2 / 183219	WormBaseID:	WBGene00003846	Length:	254	Species:	Caenorhabditis elegans

Alignment Length:	130	Identity:	44/130 - (33%)
Similarity:	61/130 - (46%)	Gaps:	8/130 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   575 VSPVVEEMPPGSDVAYVCPTCGQMFSLHDRLAKHMASRHKSRNPANDIAKAYSCDVCRRSFARSD 639
            |||   :|.|....|.|.|     |..:|:....:..|.::...|....|.:.|..|.|.|.:|.
Worm    81 VSP---KMSPTLTTAAVRP-----FVPYDQPWFMIPGRGRTTGRAARPKKEFICKYCDRHFTKSY 137

  Fly   640 MLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGEKPYKCPQCPYAACRRDMITRHMRTH 704
            .|..|.|.||..:||:|.|||:.|.|.|||..|:..|..::|:||..|....|:...:..|..||
Worm   138 NLLIHERTHTDERPYSCDVCGKAFRRQDHLRDHKYIHQKDRPFKCEICGKGFCQSRTLLVHRATH 202

Fly 705 704
Worm 203 202

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
klu	NP_001261690.1	FYDLN_acid	<182..248	CDD:302856
		C2H2 Zn finger	592..613	CDD:275368	3/20 (15%)
		COG5048	607..>687	CDD:227381	29/79 (37%)
		zf-C2H2	626..648	CDD:278523	8/21 (38%)
		C2H2 Zn finger	628..648	CDD:275368	8/19 (42%)
		zf-H2C2_2	640..665	CDD:290200	12/24 (50%)
		C2H2 Zn finger	656..676	CDD:275368	10/19 (53%)
		zf-H2C2_2	668..690	CDD:290200	8/21 (38%)
		C2H2 Zn finger	684..704	CDD:275368	4/19 (21%)
odd-2	NP_509032.1	zf-C2H2	124..146	CDD:278523	8/21 (38%)
		C2H2 Zn finger	126..146	CDD:275368	8/19 (42%)
		zf-H2C2_2	138..163	CDD:290200	12/24 (50%)
		C2H2 Zn finger	154..174	CDD:275368	10/19 (53%)
		zf-H2C2_2	166..189	CDD:290200	8/22 (36%)
		zf-C2H2	180..202	CDD:278523	5/21 (24%)
		C2H2 Zn finger	182..202	CDD:275368	4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000