DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and ZNF543

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_998763.2 Gene:ZNF543 / 125919 HGNCID:25281 Length:600 Species:Homo sapiens


Alignment Length:152 Identity:53/152 - (34%)
Similarity:78/152 - (51%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 VASPTTKETVAWR---YNLDV-SPVVEEMPPGSDVAYVCPTCGQMFSLHDRLAKHMASRHKSRNP 618
            |.:..|::.|:..   |..|. .||.:.:......:|.|..||::|..:..|.:|        ..
Human   163 VCTKITQKQVSTEGDLYECDSHGPVTDALIREEKNSYKCEECGKVFKKNALLVQH--------ER 219

  Fly   619 ANDIAKAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGEKPYK 683
            .:...|.|.|..|.::|::|..|.:|:.:|||.|||.|..||:.|:|..||:.|||.|:||||||
Human   220 IHTQVKPYECTECGKTFSKSTHLLQHLIIHTGEKPYKCMECGKAFNRRSHLTRHQRIHSGEKPYK 284

  Fly   684 CPQCPYAACRRDMITRHMRTHT 705
            |.:|..|...|.....|.|:||
Human   285 CSECGKAFTHRSTFVLHHRSHT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856
C2H2 Zn finger 592..613 CDD:275368 6/20 (30%)
COG5048 607..>687 CDD:227381 33/79 (42%)
zf-C2H2 626..648 CDD:278523 7/21 (33%)
C2H2 Zn finger 628..648 CDD:275368 6/19 (32%)
zf-H2C2_2 640..665 CDD:290200 12/24 (50%)
C2H2 Zn finger 656..676 CDD:275368 10/19 (53%)
zf-H2C2_2 668..690 CDD:290200 14/21 (67%)
C2H2 Zn finger 684..704 CDD:275368 6/19 (32%)
ZNF543NP_998763.2 KRAB 9..69 CDD:214630
COG5048 <75..329 CDD:227381 53/152 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..131
C2H2 Zn finger 201..221 CDD:275368 6/27 (22%)
COG5048 223..562 CDD:227381 39/84 (46%)
C2H2 Zn finger 229..249 CDD:275368 6/19 (32%)
C2H2 Zn finger 257..277 CDD:275368 10/19 (53%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
C2H2 Zn finger 313..333 CDD:275368
C2H2 Zn finger 341..361 CDD:275368
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..417 CDD:275368
C2H2 Zn finger 425..445 CDD:275368
C2H2 Zn finger 453..473 CDD:275368
C2H2 Zn finger 481..501 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12228
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.