DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klu and si:dkeyp-113d7.10

DIOPT Version :9

Sequence 1:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_009292272.1 Gene:si:dkeyp-113d7.10 / 100003103 ZFINID:ZDB-GENE-061207-80 Length:495 Species:Danio rerio


Alignment Length:600 Identity:117/600 - (19%)
Similarity:192/600 - (32%) Gaps:218/600 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 KQRKRKRLSAVL---DKLHHNN----------NNNNNNNNETHSNGMACKAEPMEMKGDLAEDAE 192
            |:::.:||.|.|   ::.:..|          |.|:.....|.|....|..:...::      .|
Zfish    47 KEQENQRLRATLQSREQAYGGNGKSNAAKGKTNTNDGTKQHTPSRSPECGVQSETLR------RE 105

  Fly   193 QDEDHDGS-------------------VPDEEDDSVDQDGDAGKYIKSEQPVSEDEEN----EQE 234
            |.|...|.                   |.|..||.:.:      :.|.|:      ||    ||.
Zfish   106 QKERAVGQLKSVMEHVLEFAVRELTKIVEDSFDDLLLE------FTKKER------ENHTLKEQL 158

  Fly   235 MDQD-IEDISGEDLELSHSDDNDQDDSPRISMSPLQLQAAQSNLPQDQN-----QPMNKENPLHV 293
            .|:. :||.....:|   ::|.|.|.:   |.|..:::..:|...|||:     :....|:....
Zfish   159 QDKKVVEDNKAVTVE---TEDQDNDSA---SPSSSKVEKQESKSLQDQSPKKEWEKEQTESTNEP 217

  Fly   294 DIKTEIPSPYDRYFPIPSPLFGYYLHTKYLNEVFRRRHDLYPSPLQHTPSSIASETETSPNAQER 358
            |.:|.|....| :.||...:||    .|:.:::::.: ::..|..|||..|....|:.....:|.
Zfish   218 DKQTVIAVAQD-WVPILDKVFG----QKWCSDLWQIK-EVTTSKEQHTGLSSGPMTDMDSLIRET 276

  Fly   359 KSSSNHVLPHALLANNSPPPSLPSPP---------RSESSVTNNVATTTTSSTTKKRSSPK---- 410
                  ::|..|.........:..||         .|.||....|...:::...::::..|    
Zfish   277 ------LMPSCLATQRRLELEVGQPPWLQADDMEVLSLSSEAQGVPVVSSTEFLQRQNIKKGDIY 335

  Fly   411 ---PKGKKGEKKPM-----PPPQERPLDLCMRNEVEPKKYKKSGSKSSLESRSAGMMPPPPALSA 467
               |.|..|:  |.     ...|.|...:..|....|.:..:...:|               :.|
Zfish   336 GFVPNGSIGD--PTIAIHGDDSQIRSPSMLQRLLTLPSQLLEDDDES---------------MDA 383

  Fly   468 ASSLESMSALSPASSSHSGHMPITSAATPNHQPPPNSPYANAMNAAHAAAAAAAAAMIKMEMPLH 532
            |.|:|  ::..||.|..|                                               
Zfish   384 APSVE--ASTEPADSQSS----------------------------------------------- 399

  Fly   533 PLHHQQMHHSQVPTTTVGVPVIKGDVASPTTKETVAWRYNLDVSPVVEEMPPGSDVAYVCPTCGQ 597
                                  ||..::...||    ..|.|     ||.....|.|        
Zfish   400 ----------------------KGPKSNQKRKE----EENED-----EEDDEDDDEA-------- 425

  Fly   598 MFSLHDRLAKHMASRHKSRNPANDIAKAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQV 662
                   ..:..:|:||.|.      |:::|..|.|.|:|:.:|..|.:.|... |..|..||:.
Zfish   426 -------TNRCESSKHKGRR------KSHACKECGRKFSRAHLLRAHRQTHEET-PNQCPQCGKS 476

  Fly   663 FSRSDHLSTHQRTHT 677
            ||:|..|..|.||||
Zfish   477 FSQSSRLQAHLRTHT 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856 17/89 (19%)
C2H2 Zn finger 592..613 CDD:275368 1/20 (5%)
COG5048 607..>687 CDD:227381 25/70 (36%)
zf-C2H2 626..648 CDD:278523 7/21 (33%)
C2H2 Zn finger 628..648 CDD:275368 7/19 (37%)
zf-H2C2_2 640..665 CDD:290200 8/24 (33%)
C2H2 Zn finger 656..676 CDD:275368 9/19 (47%)
zf-H2C2_2 668..690 CDD:290200 5/9 (56%)
C2H2 Zn finger 684..704 CDD:275368
si:dkeyp-113d7.10XP_009292272.1 COG5048 <430..>493 CDD:227381 25/68 (37%)
zf-C2H2 441..463 CDD:278523 7/21 (33%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-C2H2 469..490 CDD:278523 9/20 (45%)
C2H2 Zn finger 470..490 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.