DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and DCP2

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_014281.1 Gene:DCP2 / 855605 SGDID:S000005062 Length:970 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:39/164 - (23%)
Similarity:65/164 - (39%) Gaps:50/164 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVREVLEEAGVVGDLGRCLGVF 84
            |.|.|.  :||.:::|||..: ..:.|..|.|.:..:|......:|||.||.|.  ||   ....
Yeast   106 RGAAIF--NENLSKILLVQGT-ESDSWSFPRGKISKDENDIDCCIREVKEEIGF--DL---TDYI 162

  Fly    85 ENNDHMHR---------------TEVFVM--NVTQELD--EWEDSRSIGRKRQWFTIDDALSQLA 130
            ::|..:.|               :|||..  .|..|:|  ||.|.:.|.:              .
Yeast   163 DDNQFIERNIQGKNYKIFLISGVSEVFNFKPQVRNEIDKIEWFDFKKISK--------------T 213

  Fly   131 LHKPTQQHYL---------MQLQHSKTLDNTNRV 155
            ::|...::||         |.|:|.:.:.|.:::
Yeast   214 MYKSNIKYYLINSMMRPLSMWLRHQRQIKNEDQL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 33/135 (24%)
DCP2NP_014281.1 DCP2 17..99 CDD:398619
Dcp2p 103..242 CDD:239644 38/157 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.