DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and PCD1

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_013252.1 Gene:PCD1 / 850844 SGDID:S000004141 Length:340 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:35/151 - (23%)
Similarity:58/151 - (38%) Gaps:37/151 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FRRRAACIC---VKSENEAEVLLVTSSRRPELW----IVPGGGVEPEEES-SVTAVREVLEEAGV 73
            |:|.:|.|.   :..:.|..|||...||....:    ..|||..:..:|: ...|.||..||.|:
Yeast    36 FKRNSAVIILLFIGMKGELRVLLTKRSRTLRSFSGDVSFPGGKADYFQETFESVARREAEEEIGL 100

  Fly    74 VGD---LGRCLG------VFENNDHMHRTEVFVMNVT-----QELDEWEDSRSI----------- 113
            ..|   |.:..|      |.:...::.||.:.|..:.     .:|::.||...:           
Yeast   101 PHDPEVLHKEFGMKLDNLVMDMPCYLSRTFLSVKPMVCFLYKDKLEKHEDKYKVPLDIRKFFGKL 165

  Fly   114 --GRKRQWFTIDDALSQLALH 132
              |.....|::  .|:.|.:|
Yeast   166 NPGETSSLFSV--PLNDLVIH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 34/149 (23%)
PCD1NP_013252.1 CoAse 38..265 CDD:239518 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.