DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and NUDT21

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_177495.2 Gene:NUDT21 / 843688 AraportID:AT1G73540 Length:198 Species:Arabidopsis thaliana


Alignment Length:123 Identity:37/123 - (30%)
Similarity:70/123 - (56%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDKDGFRRRAACICVKSE----NEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVREVLEEAG 72
            |:..|:|:...|:..:.:    .|.||||:::.::.:..::|.||.|.:|.....|:||.:||||
plant    55 YNTAGYRQVVGCVPYRYKKHGGGEIEVLLISAQKKGKGMLLPKGGWEIDESIEEAALRETIEEAG 119

  Fly    73 VVGDLGRCLG--VFENNDH--MHRTEVFVMNVTQELDEWEDSRSIGRKRQWFTIDDAL 126
            |.|.|...||  .:::..|  :|...:|.:.|:|:.:.|.:|..  |:|:|.::.:|:
plant   120 VTGQLEESLGKWQYKSKRHTMIHDGHMFPLLVSQQFEIWPESEF--RQRKWVSLSEAI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 34/116 (29%)
NUDT21NP_177495.2 Nudix_Hydrolase_9 62..184 CDD:240024 34/116 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3889
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2515
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 1 1.000 - - oto3716
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.