DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and NUDT18

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_172939.1 Gene:NUDT18 / 838051 AraportID:AT1G14860 Length:176 Species:Arabidopsis thaliana


Alignment Length:171 Identity:50/171 - (29%)
Similarity:81/171 - (47%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKEKPNSTRIYDKDGFRRRAACICVKSE--------NEAEVLLVTSSRRPELWIVPGGGVEPEE 57
            :|......::.|:| |.|:...||..:.:        :|.|||:: ||::....:.|.||.|.:|
plant     4 LVSRTGRQSQRYNK-GRRQVVGCIPYRLKISSDGTISDEFEVLVI-SSQKGHALMFPKGGWELDE 66

  Fly    58 ESSVTAVREVLEEAGVVGDLGRCLGVFENNDHMHRTE-------VFVMNVTQELDEWEDSRSIGR 115
            .....|.||.||||||||::.|.||.:   |.:.:::       :|.|.|.:||:.|.:...  |
plant    67 SVEEAASRESLEEAGVVGNVERQLGKW---DFLSKSKGTFYEGFMFPMLVKEELELWPEQHL--R 126

  Fly   116 KRQWFTIDDA-------------------LSQLALHKPTQQ 137
            :|.|..:|:|                   ||.|:| ||.::
plant   127 QRIWMKVDEARDACRDWWMKEALDVLVQRLSLLSL-KPMEE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 45/151 (30%)
NUDT18NP_172939.1 Nudix_Hydrolase_9 21..146 CDD:240024 39/130 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3889
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2515
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.